Gene Information

Name : irlR (PSPA7_5607)
Accession : YP_001350928.1
Strain : Pseudomonas aeruginosa PA7
Genome accession: NC_009656
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5771997 - 5772686 bp
Length : 690 bp
Strand : +
Note : Annotation generated by automatically transferring the annotation from the manually curated GenBank accession AE004091; identified by match to protein family HMM PF00072; match to protein family HMM PF00486; match to protein family HMM TIGR01387

DNA sequence :
ATGCGCATCCTGGTGGTCGAAGACGACGCGAAGACCGGCGAATACCTGAAGAAGGGCCTCGGCGAGTCGGGCTATGCGGT
CGACTGGTCGCGGCACGGCGCCGACGGCCTCTACCTGGCGCTGGAGAACCGCTACGACCTGGTGGTCCTCGACGTGATGC
TGCCCGGCCTGGACGGCTGGCAGATCATGGAGGTGCTGCGCAAGAAGCACGACGTGCCGGTGCTCTTCCTCACCGCCCGC
GACCAGTTGCAGGACCGCATCCGTGGCCTCGAGCTGGGTGCCGACGACTACCTGGTGAAACCCTTCTCCTTCACCGAACT
GCTGCTGCGCATCCGCACCCTGCTGCGCCGCGGCGTGGTACGCGAGGCCGAGCAGGTGCAGCTCGCCGACCTGCACCTGG
ACGTGCTGCGGCGCAAGGTCAGCCGCCAGGGCCAGCTGATCGCCCTGACCAACAAGGAGTTCGCCCTCCTGCACCTGCTG
ATGCGCCGCGAGGGCGAGGTGCTGTCGCGCACCCTGATCGCCTCGGAGGTCTGGGACATGAATTTCGACAGCGATACCAA
CGTCGTCGACGTGGCGATCAAGCGCCTGCGCGCCAAGGTCGACAATCCCTTCCCGAACAAGCTGATCCATACCGTGCGCG
GCATCGGCTACGTCTGCGAGGAGCGCCCGTGCCCGCCCGCCGCTCCCTGA

Protein sequence :
MRILVVEDDAKTGEYLKKGLGESGYAVDWSRHGADGLYLALENRYDLVVLDVMLPGLDGWQIMEVLRKKHDVPVLFLTAR
DQLQDRIRGLELGADDYLVKPFSFTELLLRIRTLLRRGVVREAEQVQLADLHLDVLRRKVSRQGQLIALTNKEFALLHLL
MRREGEVLSRTLIASEVWDMNFDSDTNVVDVAIKRLRAKVDNPFPNKLIHTVRGIGYVCEERPCPPAAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-52 58
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-53 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_001350928.1 two-component response regulator BAC0125 Protein 2e-63 65
irlR YP_001350928.1 two-component response regulator BAC0197 Protein 3e-65 62
irlR YP_001350928.1 two-component response regulator BAC0083 Protein 3e-58 61
irlR YP_001350928.1 two-component response regulator BAC0308 Protein 3e-56 60
irlR YP_001350928.1 two-component response regulator BAC0111 Protein 1e-56 59
irlR YP_001350928.1 two-component response regulator BAC0638 Protein 2e-52 57
irlR YP_001350928.1 two-component response regulator BAC0347 Protein 2e-50 57
irlR YP_001350928.1 two-component response regulator AE000516.2.gene3505. Protein 2e-30 43
irlR YP_001350928.1 two-component response regulator U82965.2.orf14.gene. Protein 3e-24 42
irlR YP_001350928.1 two-component response regulator AE016830.1.gene1681. Protein 2e-30 41
irlR YP_001350928.1 two-component response regulator NC_002952.2859905.p0 Protein 7e-27 41
irlR YP_001350928.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-26 41
irlR YP_001350928.1 two-component response regulator NC_003923.1003749.p0 Protein 9e-27 41
irlR YP_001350928.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-26 41
irlR YP_001350928.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-26 41
irlR YP_001350928.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-26 41
irlR YP_001350928.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-26 41
irlR YP_001350928.1 two-component response regulator NC_007622.3794472.p0 Protein 8e-27 41
irlR YP_001350928.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-26 41
irlR YP_001350928.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_001350928.1 two-component response regulator VFG0596 Protein 5e-54 57
irlR YP_001350928.1 two-component response regulator VFG1390 Protein 5e-34 45
irlR YP_001350928.1 two-component response regulator VFG1386 Protein 1e-30 44
irlR YP_001350928.1 two-component response regulator VFG1389 Protein 2e-28 42
irlR YP_001350928.1 two-component response regulator VFG0473 Protein 2e-25 41