Gene Information

Name : mprA (B737_5594)
Accession : YP_008461926.1
Strain : Amycolatopsis mediterranei RB
Genome accession: NC_022116
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 6288406 - 6289101 bp
Length : 696 bp
Strand : -
Note : -

DNA sequence :
ATGCGCCTGCTCGTCGTGGACGACGACCCGGATGTCCGGGACAGCCTGCAGCGCAGCCTCGAGTTCGAAGGGTACGAAGT
GGACACTGCGGGGGACGGGGCCCAGGCGCTGCGTCTGGTGCTGGCCGCCTCCGGCGGGGCACGGCCCGACCTCACGATCC
TCGACCTGATGATGCCCGACGTGGACGGGATGGAGACCTGCCGCAGGCTGCGCGAGGCGGGCGACCGGATGCCGGTGCTG
ATGCTGACCGCCCGCGACGGCCTCGGCGACAAGGTGATGGGCCTGGACGCGGGCGCCGACGACTACCTGGTCAAGCCGTT
CGCGCTGGAGGAGCTGCTGGCCAGGGTGCGGGCCCTGCTCAAGCTGAACCGCCGTCCTCCGGACGACCGGCCGGGTATGG
CGCCGCGCGAGTTCGAGGACCTCCGGCTCGATCCCTCGAGCCGCGAGGTGACGAGGGCCGGGCGCCCGATCACGCTGACC
CCCACCGAGTTCGACCTGCTGGCCGTCTTCCTCGACGCTCCGGGCCAGGTGCTGTCCCGAGCGCGCCTGCAGCAGGCGGT
GTGGGGCCACGACCCCGGCACGAACAACCTGGACGTCTACATCGGGTACCTCCGGCGCAAGACCGAAGCGGGCGGGCGGC
CCCGGTTGCTGCACACGGTTCGCGGCGTCGGATTCACCCTCCGCGTGACACCATGA

Protein sequence :
MRLLVVDDDPDVRDSLQRSLEFEGYEVDTAGDGAQALRLVLAASGGARPDLTILDLMMPDVDGMETCRRLREAGDRMPVL
MLTARDGLGDKVMGLDAGADDYLVKPFALEELLARVRALLKLNRRPPDDRPGMAPREFEDLRLDPSSREVTRAGRPITLT
PTEFDLLAVFLDAPGQVLSRARLQQAVWGHDPGTNNLDVYIGYLRRKTEAGGRPRLLHTVRGVGFTLRVTP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-23 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_008461926.1 two-component system response regulator BAC0111 Protein 1e-27 45
mprA YP_008461926.1 two-component system response regulator BAC0347 Protein 7e-25 44
mprA YP_008461926.1 two-component system response regulator AE000516.2.gene3505. Protein 1e-27 43
mprA YP_008461926.1 two-component system response regulator BAC0487 Protein 3e-21 42
mprA YP_008461926.1 two-component system response regulator BAC0308 Protein 7e-25 42
mprA YP_008461926.1 two-component system response regulator BAC0083 Protein 3e-26 42
mprA YP_008461926.1 two-component system response regulator BAC0638 Protein 3e-19 42
mprA YP_008461926.1 two-component system response regulator NC_007793.3914065.p0 Protein 1e-27 41
mprA YP_008461926.1 two-component system response regulator NC_002758.1121390.p0 Protein 1e-27 41
mprA YP_008461926.1 two-component system response regulator NC_010079.5776364.p0 Protein 1e-27 41
mprA YP_008461926.1 two-component system response regulator NC_002952.2859858.p0 Protein 1e-27 41
mprA YP_008461926.1 two-component system response regulator NC_007622.3794948.p0 Protein 1e-27 41
mprA YP_008461926.1 two-component system response regulator NC_003923.1003417.p0 Protein 1e-27 41
mprA YP_008461926.1 two-component system response regulator NC_013450.8614146.p0 Protein 1e-27 41
mprA YP_008461926.1 two-component system response regulator NC_002951.3238224.p0 Protein 1e-27 41
mprA YP_008461926.1 two-component system response regulator CP004022.1.gene3215. Protein 1e-19 41
mprA YP_008461926.1 two-component system response regulator BAC0125 Protein 1e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_008461926.1 two-component system response regulator VFG1390 Protein 1e-47 53
mprA YP_008461926.1 two-component system response regulator VFG1389 Protein 7e-34 49
mprA YP_008461926.1 two-component system response regulator VFG1386 Protein 8e-36 44
mprA YP_008461926.1 two-component system response regulator VFG0596 Protein 1e-23 42