Gene Information

Name : BMB171_C0492 (BMB171_C0492)
Accession : YP_003663030.1
Strain : Bacillus thuringiensis BMB171
Genome accession: NC_014171
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 575706 - 576377 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGCGTTTACTTGTAGTAGAAGATAATGCTTCGTTATTAGAGTCTATCGTACAAATTTTACGTGATGAATTTGAAGTAGA
TACGGCAATAAATGGAGAAGATGGATTGTTTTTAGCTCTTCAAAATATATATGATGCAATTTTGCTGGATGTGATGATGC
CAGGGATGGACGGATTTGAAGTGATTCAAAAAATACGAGATGAAAAGATTGAAACACCAGTCCTGTTTTTGACAGCGAGA
GATTCTTTAGAAGATCGGGTGAAGGGATTGGACTTTGGTGGAGATGACTATATTGTTAAGCCATTTCAGGCCCCTGAATT
AAAAGCGAGAATTCGTGCTTTACTACGCAGAAGTGGTAGTTTAACAACGCAGCAAACAATTCGCTATAAAGGCATTGAAT
TGTTCGGAAAAGATAAAGATGTTCAAGTAGATGGAAAAGGTATGAAGTTATCATTAAAACAATATGAGCTTCTAGAGTAC
CTTGTTCAAAATAGCGGAAAGATTTTAATGCGTGAACAAATTTTTGATCGTGTTTGGGGATTTGATTCAGATACGACAGT
AGCGATTGTAGAAGTGTATGTGCATCATTTACGTAAAAAATTAGAGCCATTCGGTTATCAGAAAGATATTCAAACCGTTC
GAGGTATTGGATATATATTAAAAGAACAATGA

Protein sequence :
MRLLVVEDNASLLESIVQILRDEFEVDTAINGEDGLFLALQNIYDAILLDVMMPGMDGFEVIQKIRDEKIETPVLFLTAR
DSLEDRVKGLDFGGDDYIVKPFQAPELKARIRALLRRSGSLTTQQTIRYKGIELFGKDKDVQVDGKGMKLSLKQYELLEY
LVQNSGKILMREQIFDRVWGFDSDTTVAIVEVYVHHLRKKLEPFGYQKDIQTVRGIGYILKEQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-36 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-35 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMB171_C0492 YP_003663030.1 two-component response regulator BAC0125 Protein 2e-36 45
BMB171_C0492 YP_003663030.1 two-component response regulator BAC0638 Protein 8e-35 44
BMB171_C0492 YP_003663030.1 two-component response regulator AE015929.1.gene1106. Protein 7e-36 42
BMB171_C0492 YP_003663030.1 two-component response regulator BAC0083 Protein 3e-40 42
BMB171_C0492 YP_003663030.1 two-component response regulator NC_007793.3914065.p0 Protein 5e-41 41
BMB171_C0492 YP_003663030.1 two-component response regulator NC_007622.3794948.p0 Protein 5e-41 41
BMB171_C0492 YP_003663030.1 two-component response regulator NC_002951.3238224.p0 Protein 5e-41 41
BMB171_C0492 YP_003663030.1 two-component response regulator NC_002952.2859858.p0 Protein 5e-41 41
BMB171_C0492 YP_003663030.1 two-component response regulator NC_013450.8614146.p0 Protein 5e-41 41
BMB171_C0492 YP_003663030.1 two-component response regulator NC_010079.5776364.p0 Protein 5e-41 41
BMB171_C0492 YP_003663030.1 two-component response regulator NC_003923.1003417.p0 Protein 5e-41 41
BMB171_C0492 YP_003663030.1 two-component response regulator NC_002758.1121390.p0 Protein 5e-41 41
BMB171_C0492 YP_003663030.1 two-component response regulator BAC0308 Protein 5e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMB171_C0492 YP_003663030.1 two-component response regulator VFG1386 Protein 4e-42 44
BMB171_C0492 YP_003663030.1 two-component response regulator VFG0596 Protein 2e-36 43
BMB171_C0492 YP_003663030.1 two-component response regulator VFG1390 Protein 1e-38 41
BMB171_C0492 YP_003663030.1 two-component response regulator VFG1389 Protein 8e-37 41