Gene Information

Name : bcf_02920 (bcf_02920)
Accession : YP_005117243.1
Strain : Bacillus cereus F837/76
Genome accession: NC_016779
Putative virulence/resistance : Virulence
Product : Two-component response regulator, malate
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 551332 - 552003 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGCGCTTACTCGTAGTAGAAGATAATGCTTCTTTATTAGAATCTATTGTCCAAATATTACACGACGAATTTGAAGTAGA
TACAGCATTGAATGGAGAAGAGGGATTATTTCTAGCATTACAAAATATATATGACGCAATTTTGCTTGATGTGATGATGC
CAGAAATGGACGGTTTTGAAGTGATTCAAAAAATACGTGATGAAAAGATTGAAACACCAGTCCTATTTTTAACAGCGAGA
GATTCTTTAGAAGATCGGGTGAAGGGATTGGATTTTGGTGGAGATGACTATATTGTTAAGCCATTTCAGGCTCCTGAATT
AAAAGCGAGAATTCGTGCTTTACTACGCAGAAGTGGTAGTTTAACAACAAAGCAAACCATTCGCTATAAAGAGATTGAAC
TGTTCGGAAAAGATAAAGATGTTCAAGTAAATGGACAAAGTATGAAGTTAACATTAAAACAATATGAGCTTCTAGAGTAC
CTTGTTCAAAATAGCGGAAAGATTTTAATGAGGGAACAAATTTTTGATCGTGTCTGGGGATTCGATTCAGATACGACAGT
AGCGATTGTAGAAGTGTATGTACATCATTTACGTAAAAAATTAGAGCCATTCGGTTATCAGAAAGATATTCAAACCGTTC
GTGGTATTGGATATATATTAAAAGAACAATGA

Protein sequence :
MRLLVVEDNASLLESIVQILHDEFEVDTALNGEEGLFLALQNIYDAILLDVMMPEMDGFEVIQKIRDEKIETPVLFLTAR
DSLEDRVKGLDFGGDDYIVKPFQAPELKARIRALLRRSGSLTTKQTIRYKEIELFGKDKDVQVNGQSMKLTLKQYELLEY
LVQNSGKILMREQIFDRVWGFDSDTTVAIVEVYVHHLRKKLEPFGYQKDIQTVRGIGYILKEQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-34 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-34 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bcf_02920 YP_005117243.1 Two-component response regulator, malate BAC0125 Protein 2e-36 44
bcf_02920 YP_005117243.1 Two-component response regulator, malate AE015929.1.gene1106. Protein 6e-37 43
bcf_02920 YP_005117243.1 Two-component response regulator, malate NC_010079.5776364.p0 Protein 2e-41 42
bcf_02920 YP_005117243.1 Two-component response regulator, malate NC_002952.2859858.p0 Protein 2e-41 42
bcf_02920 YP_005117243.1 Two-component response regulator, malate NC_007622.3794948.p0 Protein 2e-41 42
bcf_02920 YP_005117243.1 Two-component response regulator, malate NC_003923.1003417.p0 Protein 2e-41 42
bcf_02920 YP_005117243.1 Two-component response regulator, malate NC_013450.8614146.p0 Protein 2e-41 42
bcf_02920 YP_005117243.1 Two-component response regulator, malate NC_002951.3238224.p0 Protein 2e-41 42
bcf_02920 YP_005117243.1 Two-component response regulator, malate NC_007793.3914065.p0 Protein 2e-41 42
bcf_02920 YP_005117243.1 Two-component response regulator, malate NC_002758.1121390.p0 Protein 2e-41 42
bcf_02920 YP_005117243.1 Two-component response regulator, malate BAC0638 Protein 4e-33 42
bcf_02920 YP_005117243.1 Two-component response regulator, malate BAC0308 Protein 1e-32 41
bcf_02920 YP_005117243.1 Two-component response regulator, malate BAC0197 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bcf_02920 YP_005117243.1 Two-component response regulator, malate VFG1386 Protein 5e-42 43
bcf_02920 YP_005117243.1 Two-component response regulator, malate VFG0596 Protein 5e-35 42
bcf_02920 YP_005117243.1 Two-component response regulator, malate VFG1390 Protein 2e-39 42
bcf_02920 YP_005117243.1 Two-component response regulator, malate VFG1389 Protein 5e-37 42