Gene Information

Name : SHJGH_5783 (SHJGH_5783)
Accession : YP_007694780.1
Strain : Streptomyces hygroscopicus TL01
Genome accession: NC_020895
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 6558426 - 6559103 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
GTGCCTTCCCTGTTGCTGATCGAGGACGACGACGCCATCCGTACGGCCCTGGAGCTCTCCCTGACGCGCCAGGGACACCG
GGTGGCCACCGCTGCCAGCGGCGAGGACGGTCTGAAGCTGCTGCGCGAGCAGCGGCCGGACCTCGTCGTGCTGGACGTGA
TGCTGCCCGGCATCGACGGGTTCGAGGTGTGCCGGCGCATCCGGCGCACGGACCAGCTGCCGATCATCCTGCTGACCGCG
CGCAGCGACGACATCGACGTCGTGGTCGGGCTGGAGTCCGGCGCCGACGACTATGTCGTCAAGCCGGTGCAGGGGCGGGT
GCTGGACGCCCGGATCCGGGCCGTGCTGCGGCGCGGGGAGCGCGAGTCCAGCGACTCGGCGACCTTCGGCAACCTCGTCA
TCGACCGGTCGGCGATGACCGTCACGAAGAACGGCGAGGACCTCCAGCTCACCCCGACCGAGCTGCGGCTGCTGCTGGAG
CTGAGCCGGCGGCCCGGTCAGGCGCTGTCCCGGCAGCAACTGCTGCGGCTGGTGTGGGAGCACGACTACCTCGGTGACTC
CCGCCTGGTCGACGCGTGTGTGCAGCGGCTGCGCGCGAAGGTGGAGGACGTGCCGTCCTCGCCGACGCTCATCCGTACCG
TCCGTGGTGTCGGCTACCGCCTGGACGCCCCTCAGTGA

Protein sequence :
MPSLLLIEDDDAIRTALELSLTRQGHRVATAASGEDGLKLLREQRPDLVVLDVMLPGIDGFEVCRRIRRTDQLPIILLTA
RSDDIDVVVGLESGADDYVVKPVQGRVLDARIRAVLRRGERESSDSATFGNLVIDRSAMTVTKNGEDLQLTPTELRLLLE
LSRRPGQALSRQQLLRLVWEHDYLGDSRLVDACVQRLRAKVEDVPSSPTLIRTVRGVGYRLDAPQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-23 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SHJGH_5783 YP_007694780.1 two-component system response regulator AE000516.2.gene3505. Protein 4e-35 47
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_002952.2859905.p0 Protein 2e-37 43
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_007622.3794472.p0 Protein 2e-37 43
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_002745.1124361.p0 Protein 2e-37 43
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_009782.5559369.p0 Protein 2e-37 43
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_002951.3237708.p0 Protein 2e-37 43
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-37 43
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_002758.1121668.p0 Protein 2e-37 43
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_009641.5332272.p0 Protein 2e-37 43
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_013450.8614421.p0 Protein 2e-37 43
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_007793.3914279.p0 Protein 2e-37 43
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_012469.1.7685629. Protein 8e-40 43
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_010079.5776364.p0 Protein 4e-32 42
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_002952.2859858.p0 Protein 4e-32 42
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_007622.3794948.p0 Protein 4e-32 42
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_003923.1003417.p0 Protein 4e-32 42
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_013450.8614146.p0 Protein 4e-32 42
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_002951.3238224.p0 Protein 4e-32 42
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_007793.3914065.p0 Protein 4e-32 42
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_002758.1121390.p0 Protein 4e-32 42
SHJGH_5783 YP_007694780.1 two-component system response regulator BAC0197 Protein 3e-26 42
SHJGH_5783 YP_007694780.1 two-component system response regulator AE015929.1.gene1106. Protein 1e-26 41
SHJGH_5783 YP_007694780.1 two-component system response regulator CP000675.2.gene1535. Protein 2e-28 41
SHJGH_5783 YP_007694780.1 two-component system response regulator BAC0125 Protein 3e-24 41
SHJGH_5783 YP_007694780.1 two-component system response regulator NC_012469.1.7686381. Protein 6e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SHJGH_5783 YP_007694780.1 two-component system response regulator VFG1389 Protein 6e-23 43
SHJGH_5783 YP_007694780.1 two-component system response regulator VFG0596 Protein 4e-24 42
SHJGH_5783 YP_007694780.1 two-component system response regulator VFG1390 Protein 9e-28 41