Gene Information

Name : Niako_5824 (Niako_5824)
Accession : YP_005011458.1
Strain : Niastella koreensis GR20-10
Genome accession: NC_016609
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 7253311 - 7254000 bp
Length : 690 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: sli:Slin_2929

DNA sequence :
ATGGAAGAAATAAAAATTTTACTGGTAGAGGATGAAAAAAAGATAGCAGAGTCATTAAAGAAAGGACTTAGCGAACAGGG
CTATCATGTAGAAGTTGCCTATGATGGCCTTATTGGAAAGAAATTGTTCGAAACCTATCCGTTCGACCTCATTATCCTGG
ATATTAACCTGCCCGGTTTAAATGGTTATGAACTGTGTAAGGAGATCCGCCGCCACAGTGAACGCATTCCGGTGGTTATG
CTAACAGCCCTCAACACCACCGCCGATAAGATCGAAGGTTTTGATGCCGGCGCCGATGATTATATTGTAAAGCCGTTCGA
TTTTAAAGAGCTGCTGGTGCGCATCAGGGCCCTGTTAAAAAGGATCTATCACAATATCCCAACGGGCAATATTCTAAAGG
TGGCCGATCTCGTTATGAACCTCGACAGTAAGGAGGTAACCCGGGCCGATAAGCCCATTTCACTTACTGCCAAGGAATTT
CAGTTGCTCGAATACCTGATCAGGAATAAGAACCGGGTAGTGTCCCGTGCAGATATTGCCCTGAATGTATGGGATATCGA
TTTCGATACCAAGACCAATGTAATTGATGTATATGTAAACTTCCTGCGTAAAAAACTGGATAAGGATTTTGAAACCCGGC
TTATACATACGCAGGTAGGCATGGGCTATATACTGAAAGAAAACCCTTAG

Protein sequence :
MEEIKILLVEDEKKIAESLKKGLSEQGYHVEVAYDGLIGKKLFETYPFDLIILDINLPGLNGYELCKEIRRHSERIPVVM
LTALNTTADKIEGFDAGADDYIVKPFDFKELLVRIRALLKRIYHNIPTGNILKVADLVMNLDSKEVTRADKPISLTAKEF
QLLEYLIRNKNRVVSRADIALNVWDIDFDTKTNVIDVYVNFLRKKLDKDFETRLIHTQVGMGYILKENP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-42 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-41 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family BAC0111 Protein 4e-48 49
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family BAC0347 Protein 7e-44 48
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family BAC0125 Protein 8e-45 47
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family BAC0638 Protein 6e-38 46
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family BAC0083 Protein 2e-43 44
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family BAC0197 Protein 1e-42 44
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 4e-37 43
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 4e-37 43
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 4e-37 43
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 4e-37 43
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 4e-37 43
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 4e-37 43
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 4e-37 43
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 4e-37 43
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family BAC0308 Protein 3e-40 43
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-42 45
Niako_5824 YP_005011458.1 two component transcriptional regulator, winged helix family VFG1390 Protein 7e-48 42