Gene Information

Name : PFLU4171 (PFLU4171)
Accession : YP_002873721.1
Strain : Pseudomonas fluorescens SBW25
Genome accession: NC_012660
Putative virulence/resistance : Virulence
Product : response regulatory protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4607654 - 4608325 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGAACATTCTCGTCGTCGAAGACGAACCCAAGGCCGGCAATTACCTGCTCAACGGCCTGCAGGAACTCGGCTACTCCGT
CAGCCTCGCCCGCGACGGTGTGGACGGCTTGCACCAAGCCCTTGAAACGCCGTTCGACGTCATCGTGCTGGATGTGATGA
TGCCGAAAATGGACGGCTGGGAAGTGCTGCGCCGTCTGCGCAAGGAAGCCGACACGCCGGTACTTTTTCTGACGGCCCGC
GACGACATCGCTGACCGTATCAAGGGCCTGGAACTGGGCGCCGATGACTACTTGATCAAGCCCTTTTCCTTCGCTGAACT
GGTAGCACGCTTGCGCACCCTGACCCGCCGCGGGCCAAGCCGCGAAGAGGAGCAGTTGCAGATCGCCGACCTGCAAATCG
ACGTGCTGAAGCGTCGCGTCACCCGTGCCGGCACGCGCATCACCTTGACCAACAAAGAGTTCGCCTTGCTGCACCTGTTC
GCGACCCACCAGGACCAGGTGCTCTCCCGCTCGCTGATTGCATCGCGGGTGTGGGACATGAATTTCGACAGCGACACCAA
CGTGGTAGACGTGGCCGTGCGGCGCCTGCGCTTGAAAATCGACGACCCTTTCCAGCTCAAGCTGATCCACAGCGTGCGTG
GCATCGGCTACCGTTTCGATACCCAACCATGA

Protein sequence :
MNILVVEDEPKAGNYLLNGLQELGYSVSLARDGVDGLHQALETPFDVIVLDVMMPKMDGWEVLRRLRKEADTPVLFLTAR
DDIADRIKGLELGADDYLIKPFSFAELVARLRTLTRRGPSREEEQLQIADLQIDVLKRRVTRAGTRITLTNKEFALLHLF
ATHQDQVLSRSLIASRVWDMNFDSDTNVVDVAVRRLRLKIDDPFQLKLIHSVRGIGYRFDTQP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-55 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-54 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PFLU4171 YP_002873721.1 response regulatory protein BAC0125 Protein 3e-67 63
PFLU4171 YP_002873721.1 response regulatory protein BAC0083 Protein 3e-68 62
PFLU4171 YP_002873721.1 response regulatory protein BAC0197 Protein 8e-65 60
PFLU4171 YP_002873721.1 response regulatory protein BAC0638 Protein 1e-60 60
PFLU4171 YP_002873721.1 response regulatory protein BAC0111 Protein 4e-64 58
PFLU4171 YP_002873721.1 response regulatory protein BAC0308 Protein 7e-59 57
PFLU4171 YP_002873721.1 response regulatory protein BAC0347 Protein 5e-57 53
PFLU4171 YP_002873721.1 response regulatory protein AE016830.1.gene1681. Protein 1e-35 42
PFLU4171 YP_002873721.1 response regulatory protein AE000516.2.gene3505. Protein 6e-30 42
PFLU4171 YP_002873721.1 response regulatory protein NC_007793.3914065.p0 Protein 4e-38 41
PFLU4171 YP_002873721.1 response regulatory protein NC_007622.3794948.p0 Protein 4e-38 41
PFLU4171 YP_002873721.1 response regulatory protein NC_002951.3238224.p0 Protein 4e-38 41
PFLU4171 YP_002873721.1 response regulatory protein NC_002952.2859858.p0 Protein 4e-38 41
PFLU4171 YP_002873721.1 response regulatory protein NC_013450.8614146.p0 Protein 4e-38 41
PFLU4171 YP_002873721.1 response regulatory protein NC_010079.5776364.p0 Protein 4e-38 41
PFLU4171 YP_002873721.1 response regulatory protein NC_003923.1003417.p0 Protein 4e-38 41
PFLU4171 YP_002873721.1 response regulatory protein NC_002758.1121390.p0 Protein 4e-38 41
PFLU4171 YP_002873721.1 response regulatory protein AE015929.1.gene1106. Protein 9e-34 41
PFLU4171 YP_002873721.1 response regulatory protein HE999704.1.gene2815. Protein 4e-31 41
PFLU4171 YP_002873721.1 response regulatory protein HE999704.1.gene1528. Protein 2e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PFLU4171 YP_002873721.1 response regulatory protein VFG0596 Protein 1e-55 53
PFLU4171 YP_002873721.1 response regulatory protein VFG1390 Protein 3e-40 45
PFLU4171 YP_002873721.1 response regulatory protein VFG1386 Protein 2e-38 45
PFLU4171 YP_002873721.1 response regulatory protein VFG1389 Protein 1e-34 44