Gene Information

Name : CDCO157_0593 (CDCO157_0593)
Accession : YP_006311449.1
Strain : Escherichia coli Xuzhou21
Genome accession: NC_017906
Putative virulence/resistance : Virulence
Product : DNA-binding transcriptional activator CusR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 678431 - 679114 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGAAACTGTTGATTGTCGAAGATGAAAAGAAAACCGGAGAATACTTGACCAAAGGGTTAACCGAAGCCGGTTTTGTGGT
CGATTTGGCCGACAACGGGCTGAATGGCTACCATCTGGCGATGACCGGAGATTATGACCTGATAATCCTCGATATTATGC
TGCCGGACGTGAACGGCTGGGATATCGTGCGCATGTTGCGCTCCGCCAATAAAGGGATGCCGATTCTGTTGCTTACCGCG
CTTGGCACCATTGAACATCGCGTCAAGGGGCTGGAGTTGGGGGCCGATGACTATCTGGTGAAGCCGTTCGCGTTTGCTGA
ACTGCTGGCGCGGGTGCGCACTCTCCTGCGGCGCGGGGCGGCGGTGATTATCGAAAGTCAGTTTCAGGTTGCCGATTTGA
TGGTCGATCTCGTCAGCCGCAAAGTCACCCGCAGCGGCACGCGCATCACTCTGACCAGTAAAGAGTTTACTCTGCTGGAG
TTTTTTCTCCGCCATCAGGGCGAAGTGCTGCCCCGCTCGCTTATCGCCTCGCAGGTATGGGACATGAATTTTGACAGCGA
CACTAACGCCATTGATGTGGCGGTGAAGCGGCTACGCGGCAAAATCGACAACGACTTTGAGCCGAAGCTGATTCAAACCG
TGCGCGGCGTGGGTTACATGCTTGAGGTGCCGGATGGTCAGTAA

Protein sequence :
MKLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTA
LGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGAAVIIESQFQVADLMVDLVSRKVTRSGTRITLTSKEFTLLE
FFLRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRGKIDNDFEPKLIQTVRGVGYMLEVPDGQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-56 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-56 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR BAC0111 Protein 6e-104 100
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR BAC0347 Protein 2e-87 83
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR BAC0083 Protein 1e-70 62
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR BAC0638 Protein 2e-63 62
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR BAC0308 Protein 1e-63 60
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR BAC0197 Protein 9e-64 59
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR BAC0125 Protein 7e-64 56
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR AE000516.2.gene3505. Protein 2e-27 42
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR NC_007793.3914065.p0 Protein 2e-34 41
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR NC_007622.3794948.p0 Protein 2e-34 41
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR NC_002951.3238224.p0 Protein 2e-34 41
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR NC_002952.2859858.p0 Protein 2e-34 41
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR NC_013450.8614146.p0 Protein 2e-34 41
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR NC_010079.5776364.p0 Protein 2e-34 41
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR NC_003923.1003417.p0 Protein 2e-34 41
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR NC_002758.1121390.p0 Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR VFG0596 Protein 1e-56 53
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR VFG1390 Protein 3e-43 43
CDCO157_0593 YP_006311449.1 DNA-binding transcriptional activator CusR VFG1389 Protein 6e-34 41