Gene Information

Name : SHJG_6021 (SHJG_6021)
Accession : YP_006247161.1
Strain : Streptomyces hygroscopicus 5008
Genome accession: NC_017765
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 6864734 - 6865429 bp
Length : 696 bp
Strand : -
Note : -

DNA sequence :
ATGGGCCAGAATGAGCCCGTGCCTTCCCTGTTGCTGATCGAGGACGACGACGCCATCCGTACGGCCCTGGAGCTCTCCCT
GACGCGCCAGGGACACCGGGTGGCCACCGCTGCCAGCGGCGAGGACGGTCTGAAGCTGCTGCGCGAGCAGCGGCCGGACC
TCGTCGTGCTGGACGTGATGCTGCCCGGCATCGACGGGTTCGAGGTGTGCCGGCGCATCCGGCGCACGGACCAGCTGCCG
ATCATCCTGCTGACCGCGCGCAGCGACGACATCGACGTCGTGGTCGGGCTGGAGTCCGGCGCCGACGACTATGTCGTCAA
GCCGGTGCAGGGGCGGGTGCTGGACGCCCGGATCCGGGCCGTGCTGCGGCGCGGGGAGCGCGAGTCCAGCGACTCGGCGA
CCTTCGGCAACCTCGTCATCGACCGGTCGGCGATGACCGTCACGAAGAACGGCGAGGACCTCCAGCTCACCCCGACCGAG
CTGCGGCTGCTGCTGGAGCTGAGCCGGCGGCCCGGTCAGGCGCTGTCCCGGCAGCAACTGCTGCGGCTGGTGTGGGAGCA
CGACTACCTCGGTGACTCCCGCCTGGTCGACGCGTGTGTGCAGCGGCTGCGCGCGAAGGTGGAGGACGTGCCGTCCTCGC
CGACGCTCATCCGTACCGTCCGTGGTGTCGGCTACCGCCTGGACGCCCCTCAGTGA

Protein sequence :
MGQNEPVPSLLLIEDDDAIRTALELSLTRQGHRVATAASGEDGLKLLREQRPDLVVLDVMLPGIDGFEVCRRIRRTDQLP
IILLTARSDDIDVVVGLESGADDYVVKPVQGRVLDARIRAVLRRGERESSDSATFGNLVIDRSAMTVTKNGEDLQLTPTE
LRLLLELSRRPGQALSRQQLLRLVWEHDYLGDSRLVDACVQRLRAKVEDVPSSPTLIRTVRGVGYRLDAPQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-23 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SHJG_6021 YP_006247161.1 two-component system response regulator AE000516.2.gene3505. Protein 5e-35 47
SHJG_6021 YP_006247161.1 two-component system response regulator NC_002952.2859905.p0 Protein 2e-37 43
SHJG_6021 YP_006247161.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-37 43
SHJG_6021 YP_006247161.1 two-component system response regulator NC_002758.1121668.p0 Protein 2e-37 43
SHJG_6021 YP_006247161.1 two-component system response regulator NC_009641.5332272.p0 Protein 2e-37 43
SHJG_6021 YP_006247161.1 two-component system response regulator NC_013450.8614421.p0 Protein 2e-37 43
SHJG_6021 YP_006247161.1 two-component system response regulator NC_007793.3914279.p0 Protein 2e-37 43
SHJG_6021 YP_006247161.1 two-component system response regulator NC_007622.3794472.p0 Protein 2e-37 43
SHJG_6021 YP_006247161.1 two-component system response regulator NC_002745.1124361.p0 Protein 2e-37 43
SHJG_6021 YP_006247161.1 two-component system response regulator NC_009782.5559369.p0 Protein 2e-37 43
SHJG_6021 YP_006247161.1 two-component system response regulator NC_002951.3237708.p0 Protein 2e-37 43
SHJG_6021 YP_006247161.1 two-component system response regulator NC_012469.1.7685629. Protein 3e-39 43
SHJG_6021 YP_006247161.1 two-component system response regulator BAC0197 Protein 4e-26 42
SHJG_6021 YP_006247161.1 two-component system response regulator NC_003923.1003417.p0 Protein 1e-31 41
SHJG_6021 YP_006247161.1 two-component system response regulator NC_013450.8614146.p0 Protein 1e-31 41
SHJG_6021 YP_006247161.1 two-component system response regulator NC_002951.3238224.p0 Protein 1e-31 41
SHJG_6021 YP_006247161.1 two-component system response regulator NC_007793.3914065.p0 Protein 1e-31 41
SHJG_6021 YP_006247161.1 two-component system response regulator NC_002758.1121390.p0 Protein 1e-31 41
SHJG_6021 YP_006247161.1 two-component system response regulator NC_010079.5776364.p0 Protein 1e-31 41
SHJG_6021 YP_006247161.1 two-component system response regulator NC_002952.2859858.p0 Protein 1e-31 41
SHJG_6021 YP_006247161.1 two-component system response regulator NC_007622.3794948.p0 Protein 1e-31 41
SHJG_6021 YP_006247161.1 two-component system response regulator CP000675.2.gene1535. Protein 3e-28 41
SHJG_6021 YP_006247161.1 two-component system response regulator BAC0125 Protein 3e-24 41
SHJG_6021 YP_006247161.1 two-component system response regulator NC_012469.1.7686381. Protein 6e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SHJG_6021 YP_006247161.1 two-component system response regulator VFG1389 Protein 6e-23 43
SHJG_6021 YP_006247161.1 two-component system response regulator VFG0596 Protein 5e-24 42
SHJG_6021 YP_006247161.1 two-component system response regulator VFG1390 Protein 9e-28 41