Gene Information

Name : Ava_0615 (Ava_0615)
Accession : YP_321134.1
Strain : Anabaena variabilis ATCC 29413
Genome accession: NC_007413
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 773994 - 774680 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGACAGCACACATTCTTTTGGTTGAAGATGAAGTTAAACTAGCGCGGTTTGTCGAATTGGAACTGAGTAGTGAAGGTTA
CAAAGTCAGTGTTGCTCATGATGGAATTACTGGACTCACCTTGGCGCGGGAGTCAACGCCTGATTTAGCGGTTCTTGATT
GGATGTTACCAGGACTATCAGGTTTAGAAATTTGCCGCCGTCTGCGAGCAACGGGTAATTCAATACCTGTAATTTTGTTA
ACTGCCAGAGATGAAGTGAGCGATCGCGTGGCAGGATTAGATGCAGGAGCTGATGATTATGTAGTCAAACCCTTTAGCAT
TGAGGAATTATTGGCAAGAATTCGCGCCCATCTGCGCCGCACCCAAGAAACAGATGAAGATTTATTGCAGTTTGAAGACC
TAAGTTTAAATCGCCGCACTCGTGAAGTGTTTCGGGGTAACAGAGCAATTGAATTAACAGCAAAGGAGTTTGATTTATTA
GAGTATCTTCTTTCCCATCCCCGTCAGGTTTTTACCAGAGATCAAATTCTCGAAAAAGTTTGGGGTTATGATTTTATGGG
TGATTCCAACATCATCGAAGTTTACATCCGTTATTTGCGGCTTAAGTTAGAAGAACACAACGAAAAGCGTTTGATTCATA
CAGTCCGTGGTGTAGGATATGCACTACGAGAATATCCCAACAAATAA

Protein sequence :
MTAHILLVEDEVKLARFVELELSSEGYKVSVAHDGITGLTLARESTPDLAVLDWMLPGLSGLEICRRLRATGNSIPVILL
TARDEVSDRVAGLDAGADDYVVKPFSIEELLARIRAHLRRTQETDEDLLQFEDLSLNRRTREVFRGNRAIELTAKEFDLL
EYLLSHPRQVFTRDQILEKVWGYDFMGDSNIIEVYIRYLRLKLEEHNEKRLIHTVRGVGYALREYPNK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-36 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-35 46
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-35 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ava_0615 YP_321134.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-49 50
Ava_0615 YP_321134.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-49 50
Ava_0615 YP_321134.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-49 50
Ava_0615 YP_321134.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-49 50
Ava_0615 YP_321134.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-49 50
Ava_0615 YP_321134.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-49 50
Ava_0615 YP_321134.1 two component transcriptional regulator AE015929.1.gene1106. Protein 7e-46 50
Ava_0615 YP_321134.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-49 50
Ava_0615 YP_321134.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-49 50
Ava_0615 YP_321134.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-46 49
Ava_0615 YP_321134.1 two component transcriptional regulator BAC0083 Protein 5e-41 45
Ava_0615 YP_321134.1 two component transcriptional regulator BAC0197 Protein 2e-38 45
Ava_0615 YP_321134.1 two component transcriptional regulator AE000516.2.gene3505. Protein 8e-41 45
Ava_0615 YP_321134.1 two component transcriptional regulator BAC0347 Protein 3e-39 44
Ava_0615 YP_321134.1 two component transcriptional regulator BAC0125 Protein 3e-42 44
Ava_0615 YP_321134.1 two component transcriptional regulator BAC0308 Protein 1e-40 44
Ava_0615 YP_321134.1 two component transcriptional regulator BAC0111 Protein 5e-40 44
Ava_0615 YP_321134.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-42 43
Ava_0615 YP_321134.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-42 43
Ava_0615 YP_321134.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-41 43
Ava_0615 YP_321134.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-41 43
Ava_0615 YP_321134.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-41 43
Ava_0615 YP_321134.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-42 43
Ava_0615 YP_321134.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-41 43
Ava_0615 YP_321134.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-41 43
Ava_0615 YP_321134.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-41 43
Ava_0615 YP_321134.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-41 43
Ava_0615 YP_321134.1 two component transcriptional regulator CP000034.1.gene3671. Protein 2e-36 43
Ava_0615 YP_321134.1 two component transcriptional regulator BAC0638 Protein 2e-34 43
Ava_0615 YP_321134.1 two component transcriptional regulator NC_002516.2.879194.p Protein 3e-29 42
Ava_0615 YP_321134.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-32 41
Ava_0615 YP_321134.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 2e-32 41
Ava_0615 YP_321134.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-32 41
Ava_0615 YP_321134.1 two component transcriptional regulator CP001918.1.gene5135. Protein 7e-19 41
Ava_0615 YP_321134.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-38 41
Ava_0615 YP_321134.1 two component transcriptional regulator CP004022.1.gene3215. Protein 7e-23 41
Ava_0615 YP_321134.1 two component transcriptional regulator BAC0288 Protein 2e-33 41
Ava_0615 YP_321134.1 two component transcriptional regulator HE999704.1.gene2815. Protein 7e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ava_0615 YP_321134.1 two component transcriptional regulator VFG1390 Protein 2e-56 56
Ava_0615 YP_321134.1 two component transcriptional regulator VFG0596 Protein 1e-36 47
Ava_0615 YP_321134.1 two component transcriptional regulator VFG1389 Protein 4e-41 47
Ava_0615 YP_321134.1 two component transcriptional regulator VFG1386 Protein 3e-46 44
Ava_0615 YP_321134.1 two component transcriptional regulator VFG1563 Protein 2e-35 42
Ava_0615 YP_321134.1 two component transcriptional regulator VFG1702 Protein 1e-35 42