Gene Information

Name : B2K_32230 (B2K_32230)
Accession : YP_006193086.1
Strain : Paenibacillus mucilaginosus K02
Genome accession: NC_017672
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 7616357 - 7617049 bp
Length : 693 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: Protein Homology.

DNA sequence :
ATGAGAGAGAAAATATTGGTCATTGACGATGATGAGAAAATTACCTCTATGCTGCGCCGTTCACTCGCCTTCGAGGGGTA
CACGGTATTCACGGCGAATCACGGCATGGACGGATTGAAGCAGATTCTGGAGAACGACCCGGATGCGGTCGTGCTCGATG
TGATGATGCCCCAGCTCGACGGCTGGGAGGTGGTCCGGCGCATCCGCGAGGGCGGCTCGAAGGTGCCCGTGCTGATGCTG
ACGGCCAAGGACGAGATCTCGGACCGGGTACGGGGGCTGGATCTCGGGGCGGACGATTATCTCGTGAAGCCGTTCGCGCT
GGAGGAGCTGCTTGCCCGCATCCGCGTGCTGCTGCGCCGCAAAGCGTCGGAGAGGGAGGAGCTTGCGGCGAACAAGCTGC
AGTATCTCGACGTCTTCATGGATCTCGACACCCGGGAAGTCTACCGCGGTGACAAGCTGATTGAGCTGACGACCAAGGAG
TTCGACCTGCTGCACCTGTTCCTGCAGAATCCGCGGCGCGTGCTGTCCCGGGATGTCATCATGGAGAAGATCTGGGGCTA
CGATTACAGCGGGGAATCCAATGTGCTTGAGGTCTATATTGCGCTGCTGCGCCAGAAGACGGAGGAGCACGGGCACAAGC
GGATCATTATGACGGTCCGGGGGGCCGGTTATGTGCTGAGAGGTGAAGCCTAA

Protein sequence :
MREKILVIDDDEKITSMLRRSLAFEGYTVFTANHGMDGLKQILENDPDAVVLDVMMPQLDGWEVVRRIREGGSKVPVLML
TAKDEISDRVRGLDLGADDYLVKPFALEELLARIRVLLRRKASEREELAANKLQYLDVFMDLDTREVYRGDKLIELTTKE
FDLLHLFLQNPRRVLSRDVIMEKIWGYDYSGESNVLEVYIALLRQKTEEHGHKRIIMTVRGAGYVLRGEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-39 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-38 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B2K_32230 YP_006193086.1 transcriptional regulator BAC0083 Protein 2e-44 47
B2K_32230 YP_006193086.1 transcriptional regulator BAC0125 Protein 2e-43 46
B2K_32230 YP_006193086.1 transcriptional regulator BAC0638 Protein 8e-40 45
B2K_32230 YP_006193086.1 transcriptional regulator HE999704.1.gene1528. Protein 1e-39 43
B2K_32230 YP_006193086.1 transcriptional regulator BAC0308 Protein 5e-42 43
B2K_32230 YP_006193086.1 transcriptional regulator HE999704.1.gene2815. Protein 2e-40 43
B2K_32230 YP_006193086.1 transcriptional regulator NC_007793.3914065.p0 Protein 9e-38 41
B2K_32230 YP_006193086.1 transcriptional regulator NC_007622.3794948.p0 Protein 9e-38 41
B2K_32230 YP_006193086.1 transcriptional regulator NC_002951.3238224.p0 Protein 9e-38 41
B2K_32230 YP_006193086.1 transcriptional regulator NC_002952.2859858.p0 Protein 9e-38 41
B2K_32230 YP_006193086.1 transcriptional regulator NC_013450.8614146.p0 Protein 9e-38 41
B2K_32230 YP_006193086.1 transcriptional regulator NC_010079.5776364.p0 Protein 9e-38 41
B2K_32230 YP_006193086.1 transcriptional regulator NC_003923.1003417.p0 Protein 9e-38 41
B2K_32230 YP_006193086.1 transcriptional regulator NC_002758.1121390.p0 Protein 9e-38 41
B2K_32230 YP_006193086.1 transcriptional regulator CP001485.1.gene721.p Protein 1e-33 41
B2K_32230 YP_006193086.1 transcriptional regulator BAC0111 Protein 2e-43 41
B2K_32230 YP_006193086.1 transcriptional regulator BAC0197 Protein 1e-37 41
B2K_32230 YP_006193086.1 transcriptional regulator AE016830.1.gene1681. Protein 1e-38 41
B2K_32230 YP_006193086.1 transcriptional regulator AE000516.2.gene3505. Protein 5e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B2K_32230 YP_006193086.1 transcriptional regulator VFG1390 Protein 2e-57 54
B2K_32230 YP_006193086.1 transcriptional regulator VFG1386 Protein 4e-50 45
B2K_32230 YP_006193086.1 transcriptional regulator VFG1389 Protein 7e-40 44
B2K_32230 YP_006193086.1 transcriptional regulator VFG0596 Protein 7e-40 42