Gene Information

Name : B479_00330 (B479_00330)
Accession : YP_007226927.1
Strain : Pseudomonas putida PC9
Genome accession: NC_019905
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 74686 - 75363 bp
Length : 678 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAATTACTCGTAGCCGAAGATGAGCCAAAAATCGGGGCCTACCTGCAGCAAGGGCTGACGGAGGCAGGCTTTACCGT
CGATCGTGTGGTCACAGGGACCGACGCGCTGCAATACGCTTTGAGCGAGGCGTATGACCTGCTGATTCTTGATGTAATGA
TGCCGGGGCTAGACGGCTGGGAGGTGCTGCGGATGGTACGTGCGGCAGGGAAAGAGGTCCCAGTCTTGTTTTTGACGGCC
CGTGATGGCGTGGACGATCGCGTGAAAGGGTTAGAACTCGGGGCTGACGATTACCTGGTCAAACCCTTTGCATTCTCGGA
ACTGCTAGCGCGTGTGCGCACTTTGCTGCGAAGAGGCAGCAGTGGCTATGCTCAGACCACTATGAAGATGGCTGACCTGG
AGGTAGACCTGCTTAAGCGCCGGGCCACCCGAAATGGCAAGCGGATCGACCTCACAGCCAAGGAGTTCTCCTTACTGGAA
CTACTCATGCGCCGACGCGGCGAGGTACTGCCGAAGTCCCTGATCGCATCGCAGGTGTGGGATATGAACTTCGACAGCGA
CACTAACGTGATCGAGGTTGCTGTTCGTAGGTTGCGGGCCAAGATTGATGACGATTTCGCCCCCAAGCTCATACATACAG
TTCGTGGCATGGGCTATCTGATGGATGTTCCCGAGTAA

Protein sequence :
MKLLVAEDEPKIGAYLQQGLTEAGFTVDRVVTGTDALQYALSEAYDLLILDVMMPGLDGWEVLRMVRAAGKEVPVLFLTA
RDGVDDRVKGLELGADDYLVKPFAFSELLARVRTLLRRGSSGYAQTTMKMADLEVDLLKRRATRNGKRIDLTAKEFSLLE
LLMRRRGEVLPKSLIASQVWDMNFDSDTNVIEVAVRRLRAKIDDDFAPKLIHTVRGMGYLMDVPE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-58 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-57 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B479_00330 YP_007226927.1 two component heavy metal response transcriptional regulator BAC0638 Protein 4e-81 84
B479_00330 YP_007226927.1 two component heavy metal response transcriptional regulator BAC0083 Protein 2e-86 83
B479_00330 YP_007226927.1 two component heavy metal response transcriptional regulator BAC0197 Protein 5e-68 65
B479_00330 YP_007226927.1 two component heavy metal response transcriptional regulator BAC0111 Protein 5e-73 63
B479_00330 YP_007226927.1 two component heavy metal response transcriptional regulator BAC0308 Protein 3e-67 63
B479_00330 YP_007226927.1 two component heavy metal response transcriptional regulator BAC0125 Protein 4e-66 61
B479_00330 YP_007226927.1 two component heavy metal response transcriptional regulator BAC0347 Protein 4e-67 59
B479_00330 YP_007226927.1 two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 2e-33 45
B479_00330 YP_007226927.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 1e-29 41
B479_00330 YP_007226927.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 3e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B479_00330 YP_007226927.1 two component heavy metal response transcriptional regulator VFG0596 Protein 6e-59 58
B479_00330 YP_007226927.1 two component heavy metal response transcriptional regulator VFG1390 Protein 3e-43 47
B479_00330 YP_007226927.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-39 46
B479_00330 YP_007226927.1 two component heavy metal response transcriptional regulator VFG1386 Protein 7e-37 42