Gene Information

Name : AB57_0661 (AB57_0661)
Accession : YP_002318064.1
Strain : Acinetobacter baumannii AB0057
Genome accession: NC_011586
Putative virulence/resistance : Virulence
Product : transcriptional activator protein CusR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 703235 - 703918 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGAGAATCTTACTAGTTGAAGATGAACAAAAAACTGGTGATTATCTAAAGCAAGGTCTTTCTGAGGCAGGATATATTAC
AGACTGGGTTACAGATGGCTTATCAGGTAAACATCAAGCTCTTTCTGAAGAATACGATCTAATCATACTAGATGTAATGT
TACCGAAGTTAGATGGCTGGAATATCATTAATGATATTCGCAAAAGTGGAAAAACTATGCCTATCCTTTTTCTCTCAGCT
CGTGATCAAATTGAAGATAGAGTTAAAGGCCTGGAATTAGGAGCTGATGATTATCTGGTTAAGCCTTTTGCTTTTGCAGA
ACTTCTTGCCCGAATTAAAACCTTACTTCGTCGCGGTCAACAAAAGGAAGATAGCAATATTATTACGATTGCTGATCTTG
AACTTGATCTTCGTAAACGTCGCGTCACACGTGCTGGACAAAGAATTGACCTTACAGCTAAAGAGTTCGCATTGATGGAA
TTATTCATGCGTAGACGTGGCGAGATTCTGCCTCGTGCTCTCATTGCTTCTCAAATATGGGATATGAATTTTGATAGTGA
TACCAACGTTGTAGAAGTCGCTATCAAACGTCTAAGAAATAAAATAGATAGTAATTTCAGTCCCAAGTTGATTCAAAACA
TCCGCGGAATGGGGTATGTCTTAGAGGTAGAAGATGACTCATAA

Protein sequence :
MRILLVEDEQKTGDYLKQGLSEAGYITDWVTDGLSGKHQALSEEYDLIILDVMLPKLDGWNIINDIRKSGKTMPILFLSA
RDQIEDRVKGLELGADDYLVKPFAFAELLARIKTLLRRGQQKEDSNIITIADLELDLRKRRVTRAGQRIDLTAKEFALME
LFMRRRGEILPRALIASQIWDMNFDSDTNVVEVAIKRLRNKIDSNFSPKLIQNIRGMGYVLEVEDDS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-57 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-56 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AB57_0661 YP_002318064.1 transcriptional activator protein CusR BAC0197 Protein 9e-73 67
AB57_0661 YP_002318064.1 transcriptional activator protein CusR BAC0638 Protein 2e-66 64
AB57_0661 YP_002318064.1 transcriptional activator protein CusR BAC0083 Protein 5e-73 63
AB57_0661 YP_002318064.1 transcriptional activator protein CusR BAC0111 Protein 7e-73 62
AB57_0661 YP_002318064.1 transcriptional activator protein CusR BAC0308 Protein 1e-67 59
AB57_0661 YP_002318064.1 transcriptional activator protein CusR BAC0125 Protein 2e-64 59
AB57_0661 YP_002318064.1 transcriptional activator protein CusR BAC0347 Protein 4e-67 58
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_007793.3914065.p0 Protein 8e-38 42
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_007622.3794948.p0 Protein 8e-38 42
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_002951.3238224.p0 Protein 8e-38 42
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_002952.2859858.p0 Protein 8e-38 42
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_013450.8614146.p0 Protein 8e-38 42
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_010079.5776364.p0 Protein 8e-38 42
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_003923.1003417.p0 Protein 8e-38 42
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_002758.1121390.p0 Protein 8e-38 42
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_007793.3914279.p0 Protein 5e-33 41
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_002951.3237708.p0 Protein 5e-33 41
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_013450.8614421.p0 Protein 5e-33 41
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_009782.5559369.p0 Protein 5e-33 41
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_009641.5332272.p0 Protein 5e-33 41
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_002745.1124361.p0 Protein 5e-33 41
AB57_0661 YP_002318064.1 transcriptional activator protein CusR NC_002758.1121668.p0 Protein 5e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AB57_0661 YP_002318064.1 transcriptional activator protein CusR VFG0596 Protein 2e-57 54
AB57_0661 YP_002318064.1 transcriptional activator protein CusR VFG1390 Protein 1e-42 41