Gene Information

Name : Sbal678_0647 (Sbal678_0647)
Accession : YP_005271884.1
Strain : Shewanella baltica OS678
Genome accession: NC_016901
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 752958 - 753641 bp
Length : 684 bp
Strand : +
Note : KEGG: ava:Ava_3453 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGAACGTATTGCTTGTCGAAGATGAACAAAAAATTGCAGATTTTATCTGTGAAGGTTTGCGTGCCAAACATTTCAACGT
CACTCATTGTGCCGATGGCAATCAAGGTTATCAGGCGGCAAGTAATAATACTCATGATGTGATTATTCTCGACATTATGC
TACCGGGCAGAGATGGTTTGGATATTCTTCGTTCGCTGCGTCAACAAGGTGTCGATACGCCCATTATTCTGCTTACGGCA
CGTAATGAATTGGGTGATCGCGTTCAAGGGTTAGACATGGGCGCTGATGATTACTTAGCAAAACCGTTTTATGTTGAAGA
GTTGCATGCTCGGATTCAAGCCTTGCTTCGACGGCATGGCGGCACACAACAGCATGTCGTTGAGGTAGGCGCGTTGCAAC
TTGATTGTATTAATCGAAGCATTAATTGTCAGGGTCAATCAGTCGAACTCACTAGCCGAGAATTTAGCTTGCTTGAACAC
TTAATGCGTTCACCTAACCAAGTATTAACCCGGGGGCAGTTGTTGGAGCATGTTTGGGGATACGACTTTGATCCTTGTAC
CAATGTTGTTGATGTGTGCATTAAACGCATCCGCAGTAAAATGGCTTCATTAGAGAAGGCCGGAAAAATGGTCGGCGCCA
TTGAGTCGATCCGCGGCACAGGTTATCGCCTGAGCATTCGATAA

Protein sequence :
MNVLLVEDEQKIADFICEGLRAKHFNVTHCADGNQGYQAASNNTHDVIILDIMLPGRDGLDILRSLRQQGVDTPIILLTA
RNELGDRVQGLDMGADDYLAKPFYVEELHARIQALLRRHGGTQQHVVEVGALQLDCINRSINCQGQSVELTSREFSLLEH
LMRSPNQVLTRGQLLEHVWGYDFDPCTNVVDVCIKRIRSKMASLEKAGKMVGAIESIRGTGYRLSIR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-37 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-38 44
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-38 44
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-38 44
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-38 44
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-38 44
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-38 44
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-38 44
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-38 44
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 6e-34 43
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family BAC0125 Protein 3e-40 42
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family BAC0083 Protein 1e-43 42
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-42 42
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-30 42
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family BAC0347 Protein 2e-40 41
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family BAC0111 Protein 4e-43 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family VFG1389 Protein 1e-38 43
Sbal678_0647 YP_005271884.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-37 41