Gene Information

Name : Taci_0717 (Taci_0717)
Accession : YP_003317232.1
Strain : Thermanaerovibrio acidaminovorans DSM 6589
Genome accession: NC_013522
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 749686 - 750366 bp
Length : 681 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: amc:MADE_03339 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA- binding domain

DNA sequence :
ATGAGGCTTCTGATCATCGAGGACAACGAGGATCTCTGTCAACTGCTCCGGGAGGGTTTTGAGGAGCTGGGGCACGAGGT
TGACACCGCCGGCGACGGCAGGAACGGCCTTGACCTCATAAGGTCCGGGAAATACGACTGCGTGATCCTGGACATCATGC
TCCCCGAGATGGACGGCTTCGAGGTGATGGATCAGGTCAGGGACGAGGGGCACGACGTTCCGGTCATCATGCTCACCGCC
AAGGACTCGGTGGAGGATCGGGTTCACGGGCTGGAGCAGGGGGCGGACGACTACCTGACCAAGCCCTTCGACTTCAAGGA
ACTGATGGCTCGGGTCAACGCCCTCATGAGGCGAAGCGGGGATCAGCGGAGGTCCATCCTCAAGTGCGGGCCCCTGACCC
TGGATCCGGTGGCCCGGGAGTGCCGGGTTGGGGACATCAAGGTTCCCTTGAGGCGGCGGGAGTTCGACATCCTGGAGCTT
CTCATGCGCTATGAGAACCAGGTGTTCAGCCGGGACAAGATAATAGCCCAGGTGTGGCAGAAGGAGTACGACGGGACCAG
CAACGTGGTGGACGTCCACATAAAGTACCTGAGGGACAAGCTTCGTCCATTCAACCTGGACATGATGGTGGTCACCGTCA
GGGGAGTGGGCTACAAGGTGGCGAATCCCGAAGGGGAGTAA

Protein sequence :
MRLLIIEDNEDLCQLLREGFEELGHEVDTAGDGRNGLDLIRSGKYDCVILDIMLPEMDGFEVMDQVRDEGHDVPVIMLTA
KDSVEDRVHGLEQGADDYLTKPFDFKELMARVNALMRRSGDQRRSILKCGPLTLDPVARECRVGDIKVPLRRREFDILEL
LMRYENQVFSRDKIIAQVWQKEYDGTSNVVDVHIKYLRDKLRPFNLDMMVVTVRGVGYKVANPEGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-37 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator BAC0125 Protein 6e-39 44
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-38 44
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 9e-35 43
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-39 43
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-39 42
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator BAC0111 Protein 4e-42 41
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-37 41
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-37 41
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-37 41
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-37 41
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-37 41
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-37 41
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-37 41
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-37 41
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator BAC0638 Protein 7e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-35 45
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-37 42
Taci_0717 YP_003317232.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-40 41