Gene Information

Name : OBV_07280 (OBV_07280)
Accession : YP_004880432.1
Strain : Oscillibacter valericigenes Sjm18-20
Genome accession: NC_016048
Putative virulence/resistance : Virulence
Product : OmpR family two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 694909 - 695571 bp
Length : 663 bp
Strand : -
Note : -

DNA sequence : 
GTGAGAATTCTGGTCGTGGAGGATGAGCCGACGCTGAATCGGCTGATTGCGGATACGTTGCGGCTGGCCCATTATGTCGT
GGATGCCTGTCCGGACGGTGAGGACGCGCTGGCGCATATGGCCTGTGCGGAGTATGATGCAGTAGTACTGGACATCATGC
TGCCGAAGGTGGACGGACTTACAATACTGCGGCGGCTCCGGTCCGAGCGGAATCGGACGCCGGTGCTTTTGCTGACCGCA
AAAGACAGCGTGGAGGACCGCGTCACCGGGCTGGATTCAGGTGCGGACGATTATCTGGTCAAGCCCTTTGCATTCAGCGA
ACTGCTGGCCCGCACCCGGGTCATGCTCCGCCGCAGCGCGGACAGCGTGGACGATATACTTTCGCTGGCGGATTTGACGA
TGGACTGCAAGGCGAGGACCGCGGCGCGCAGCCAAGAGCCTGTCTCGCTGTCCAGCCGGGAGTTTGATATTCTGGAATAC
CTGCTGCGCAACAAGGGATTTATCCTTTCCCGGGATAAAATCAGCAGCCACGTCTGGAACTATGACGGCGCGTCCAACGT
GGTGGATGTTTACATCCGCTATCTTCGTAAAAAAATCGACGAGAACCGAGAGCCGAAGCTGATCCACACAATCCGCGGCG
CGGGCTATGTGCTGCGGGTGTGA

Protein sequence : 
MRILVVEDEPTLNRLIADTLRLAHYVVDACPDGEDALAHMACAEYDAVVLDIMLPKVDGLTILRRLRSERNRTPVLLLTA
KDSVEDRVTGLDSGADDYLVKPFAFSELLARTRVMLRRSADSVDDILSLADLTMDCKARTAARSQEPVSLSSREFDILEY
LLRNKGFILSRDKISSHVWNYDGASNVVDVYIRYLRKKIDENREPKLIHTIRGAGYVLRV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-38 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-37 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OBV_07280 YP_004880432.1 OmpR family two-component response regulator BAC0197 Protein 4e-47 50
OBV_07280 YP_004880432.1 OmpR family two-component response regulator BAC0125 Protein 2e-45 49
OBV_07280 YP_004880432.1 OmpR family two-component response regulator BAC0308 Protein 5e-44 48
OBV_07280 YP_004880432.1 OmpR family two-component response regulator BAC0083 Protein 2e-45 48
OBV_07280 YP_004880432.1 OmpR family two-component response regulator BAC0111 Protein 7e-47 47
OBV_07280 YP_004880432.1 OmpR family two-component response regulator BAC0638 Protein 2e-40 47
OBV_07280 YP_004880432.1 OmpR family two-component response regulator NC_013450.8614146.p0 Protein 4e-41 44
OBV_07280 YP_004880432.1 OmpR family two-component response regulator NC_002951.3238224.p0 Protein 4e-41 44
OBV_07280 YP_004880432.1 OmpR family two-component response regulator NC_007793.3914065.p0 Protein 4e-41 44
OBV_07280 YP_004880432.1 OmpR family two-component response regulator NC_002758.1121390.p0 Protein 4e-41 44
OBV_07280 YP_004880432.1 OmpR family two-component response regulator NC_010079.5776364.p0 Protein 4e-41 44
OBV_07280 YP_004880432.1 OmpR family two-component response regulator NC_002952.2859858.p0 Protein 4e-41 44
OBV_07280 YP_004880432.1 OmpR family two-component response regulator NC_007622.3794948.p0 Protein 4e-41 44
OBV_07280 YP_004880432.1 OmpR family two-component response regulator NC_003923.1003417.p0 Protein 4e-41 44
OBV_07280 YP_004880432.1 OmpR family two-component response regulator HE999704.1.gene1528. Protein 1e-36 44
OBV_07280 YP_004880432.1 OmpR family two-component response regulator BAC0347 Protein 4e-41 44
OBV_07280 YP_004880432.1 OmpR family two-component response regulator AE015929.1.gene1106. Protein 7e-36 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OBV_07280 YP_004880432.1 OmpR family two-component response regulator VFG0596 Protein 1e-38 47
OBV_07280 YP_004880432.1 OmpR family two-component response regulator VFG1390 Protein 6e-46 46
OBV_07280 YP_004880432.1 OmpR family two-component response regulator VFG1386 Protein 2e-44 44
OBV_07280 YP_004880432.1 OmpR family two-component response regulator VFG1389 Protein 1e-39 44