Gene Information

Name : KKY_788 (KKY_788)
Accession : YP_004898577.1
Strain : Pelagibacterium halotolerans B2
Genome accession: NC_016078
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with PhoQ
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 745196 - 745867 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
GTGAAGATATTGCTGATTGAAGACGACCGCGAAGCGGCGACCTATCTCATTCAGGCCCTCGACGAATGCGGCCATGTCAC
CCACCACGCCAGCGACGGCGAGACCGGCTTTGCCATGGCGTCGGGCATGGAATACGACGTTCTGATCGTCGACCGCATGC
TGCCGCGCCGCGACGGCCTCTCGATCATCGAATCCCTGCGCGCCGAAGACGATAACACGCCCGTTCTGATCCTGTCGGCG
CTGGGCGAGGTCGATGACCGCGTCACCGGTTTGCGCGCCGGCGGCGATGACTATCTCGTCAAACCCTACGCCTTTTCCGA
ACTCCTGGCCCGCATCGAAGTGATGGCGCGCCGCTCGGCCCCGAGCGAAGCGGCCACCTCCTACCAGGTGGGCGATCTCA
TTCTCGATCGGCTGTCGCGCAAGGTCGAGAGGGCATCGGAGACCATTGTTCTGCAGCCCCGTGAATTTCGCCTCCTCGAA
TATCTCATGAAAAACGCCGGGCGGGTCGTCACCCGCACCATGCTGCTCGAAAATGTCTGGGATTATCATTTCGACCCCCA
GACCAATGTTATCGACGTCCACATGTCCCGCCTGCGCGGAAAGGTGGACAAGGGCCATCAGCGCCAGTTGCTCCAGACCG
TGCGTGGCGCGGGATATATGATCCGTGACTGA

Protein sequence :
MKILLIEDDREAATYLIQALDECGHVTHHASDGETGFAMASGMEYDVLIVDRMLPRRDGLSIIESLRAEDDNTPVLILSA
LGEVDDRVTGLRAGGDDYLVKPYAFSELLARIEVMARRSAPSEAATSYQVGDLILDRLSRKVERASETIVLQPREFRLLE
YLMKNAGRVVTRTMLLENVWDYHFDPQTNVIDVHMSRLRGKVDKGHQRQLLQTVRGAGYMIRD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-37 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KKY_788 YP_004898577.1 response regulator in two-component regulatory system with PhoQ BAC0347 Protein 2e-47 47
KKY_788 YP_004898577.1 response regulator in two-component regulatory system with PhoQ BAC0125 Protein 2e-44 46
KKY_788 YP_004898577.1 response regulator in two-component regulatory system with PhoQ BAC0083 Protein 2e-44 45
KKY_788 YP_004898577.1 response regulator in two-component regulatory system with PhoQ BAC0111 Protein 8e-53 45
KKY_788 YP_004898577.1 response regulator in two-component regulatory system with PhoQ BAC0308 Protein 2e-41 43
KKY_788 YP_004898577.1 response regulator in two-component regulatory system with PhoQ BAC0197 Protein 1e-42 42
KKY_788 YP_004898577.1 response regulator in two-component regulatory system with PhoQ BAC0638 Protein 6e-37 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KKY_788 YP_004898577.1 response regulator in two-component regulatory system with PhoQ VFG0596 Protein 9e-38 42
KKY_788 YP_004898577.1 response regulator in two-component regulatory system with PhoQ VFG1389 Protein 8e-32 42
KKY_788 YP_004898577.1 response regulator in two-component regulatory system with PhoQ VFG1390 Protein 5e-39 41