Gene Information

Name : Pmob_0851 (Pmob_0851)
Accession : YP_001567898.1
Strain : Petrotoga mobilis SJ95
Genome accession: NC_010003
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 898424 - 899092 bp
Length : 669 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mta:Moth_1478 two component transcriptional regulator, winged helix family

DNA sequence :
ATGAAAATCCTTGTTGTTGAGGATGAAGAAAAACTTGCTTATATAATAAAAAGGGGACTTACGGAAGAAGGATACTGTAT
CGATGTTGTTTACGACGGAGAAGAAGCGGAAAACTATGCAAAATATTCTTCATACGATTTGATAATTTTAGATATAATGC
TACCAAAAAAAGATGGGATAACCGTTTGTCAAAATATAAGAAAAGAAAACATCAATACTCCAATATTGATGTTAACTGCA
AAGGATAGTGTGGGGGACAGAGTTAAGGGTTTGGATTCCGGAGCGGATGATTATTTGGTAAAACCTTTTGATTTCGATGA
ATTATTTGCAAGGGTTAGATCTTTATTAAGAAGAGAAAGTTTCACTCGTAACCCAGTTCTTAAAGTGGGAGATTTAACCT
TAAACACCTTAACAAGAGAGGTTTGGATGGGGGAGAAAAAATTGAAATTAACCCCGAAGGAATACAATATCTTGGAGTAT
TTTATGAGAAACCCAAAAATAGTAGTTACCAGAACTATTCTTGAGGAGAAAATGTGGGATATCGATTTTGAAGGTAACTC
AAACGTTATAGACGTGTATATAAGAAGGTTGAGAAAGAAAATTGGAGATAAAGAAGGTAAAATTCTAGAGACTGTTAGAG
GAGCTGGTTATAGGTTAACGGTATCTTAA

Protein sequence :
MKILVVEDEEKLAYIIKRGLTEEGYCIDVVYDGEEAENYAKYSSYDLIILDIMLPKKDGITVCQNIRKENINTPILMLTA
KDSVGDRVKGLDSGADDYLVKPFDFDELFARVRSLLRRESFTRNPVLKVGDLTLNTLTREVWMGEKKLKLTPKEYNILEY
FMRNPKIVVTRTILEEKMWDIDFEGNSNVIDVYIRRLRKKIGDKEGKILETVRGAGYRLTVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-39 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-38 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pmob_0851 YP_001567898.1 two component transcriptional regulator BAC0197 Protein 3e-43 50
Pmob_0851 YP_001567898.1 two component transcriptional regulator BAC0083 Protein 4e-45 48
Pmob_0851 YP_001567898.1 two component transcriptional regulator BAC0308 Protein 5e-43 47
Pmob_0851 YP_001567898.1 two component transcriptional regulator BAC0111 Protein 3e-46 45
Pmob_0851 YP_001567898.1 two component transcriptional regulator BAC0125 Protein 4e-44 45
Pmob_0851 YP_001567898.1 two component transcriptional regulator BAC0638 Protein 2e-40 45
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-35 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-35 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-35 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-35 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-35 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-35 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-35 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-35 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator BAC0347 Protein 2e-41 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-30 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_002516.2.879194.p Protein 1e-30 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-38 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-38 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-38 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-38 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-38 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-38 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-38 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-38 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-38 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-38 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator BAC0487 Protein 6e-31 42
Pmob_0851 YP_001567898.1 two component transcriptional regulator AE015929.1.gene1106. Protein 4e-30 42
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_012469.1.7685629. Protein 9e-29 41
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-29 41
Pmob_0851 YP_001567898.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pmob_0851 YP_001567898.1 two component transcriptional regulator VFG0596 Protein 1e-39 46
Pmob_0851 YP_001567898.1 two component transcriptional regulator VFG1390 Protein 3e-43 43
Pmob_0851 YP_001567898.1 two component transcriptional regulator VFG0473 Protein 8e-35 42