Gene Information

Name : cusR (BMULJ_06249)
Accession : YP_001942028.1
Strain :
Genome accession: NC_010802
Putative virulence/resistance : Virulence
Product : two-component system copper resistance phosphate regulon response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 99462 - 100145 bp
Length : 684 bp
Strand : -
Note : COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain, Ralstonia solanacearum; CusR protein; KEGG, K07665

DNA sequence :
ATGCGAATTCTGATTGTCGAGGATGAACCGAAGACGGGCGCGTATCTGCGCAAGGGCCTGACCGAGGCCGGCTACGTTGT
CGACTGGGTCGAGGACGGCATCACGGGCCAGCACCAGGCCGAAACGGAGGAGTACGACCTGCTCGTGCTCGACGTGATGC
TGCCCGGGCAGGACGGCTGGACGCTGCTGCAGAACCTGCGGCGCAGCAAATCGACGCCCGTGCTGTTCCTCACTGCCCGT
GACGACGTCGGCGATCGCGTGAAGGGGCTCGAGCTCGGCGCGGACGACTATCTCGCGAAGCCGTTCGACTTCGTCGAGCT
GACCGCGCGCATCAAGTCGATCCTGCGGCGCGGCCAGCCGCGCGATTCGAACACGCTGCGCGCGGCCGATCTCGAACTGG
ACCTGACCCGCCGCAAGGCCACGCGGCAGGGCGACACGATCCTGCTGACCGCGAAGGAGTTCGCGCTGCTGTGGCTGCTG
ATGCGCCGCGAAGGGGAGATCCTGCCGCGCGCGACGATCGCGTCGCAGGTATGGGACATGAACTTCAACAGCGACACGAA
CGTCGTCGATTCGGCGATCCGCCGGCTGCGCTCGAAGATCGACGACGCGTACGAACCGAAGCTGATCCACACGGTGCGCG
GCATGGGCTACGTGCTCGAAGCGCGCGGCGGCGCGGCCGCATGA

Protein sequence :
MRILIVEDEPKTGAYLRKGLTEAGYVVDWVEDGITGQHQAETEEYDLLVLDVMLPGQDGWTLLQNLRRSKSTPVLFLTAR
DDVGDRVKGLELGADDYLAKPFDFVELTARIKSILRRGQPRDSNTLRAADLELDLTRRKATRQGDTILLTAKEFALLWLL
MRREGEILPRATIASQVWDMNFNSDTNVVDSAIRRLRSKIDDAYEPKLIHTVRGMGYVLEARGGAAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-58 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-56 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator BAC0197 Protein 3e-94 86
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator BAC0083 Protein 5e-66 62
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator BAC0125 Protein 5e-68 62
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator BAC0638 Protein 1e-59 61
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator BAC0308 Protein 1e-62 60
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator BAC0111 Protein 1e-63 58
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator BAC0347 Protein 5e-59 55
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_003923.1003417.p0 Protein 2e-35 43
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_013450.8614146.p0 Protein 2e-35 43
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_002951.3238224.p0 Protein 2e-35 43
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_007793.3914065.p0 Protein 2e-35 43
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_002758.1121390.p0 Protein 2e-35 43
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_010079.5776364.p0 Protein 2e-35 43
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_002952.2859858.p0 Protein 2e-35 43
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_007622.3794948.p0 Protein 2e-35 43
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator AE015929.1.gene1106. Protein 8e-30 42
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_002952.2859905.p0 Protein 2e-33 41
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_007793.3914279.p0 Protein 1e-33 41
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_002745.1124361.p0 Protein 1e-33 41
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_009782.5559369.p0 Protein 1e-33 41
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_007622.3794472.p0 Protein 2e-33 41
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_002951.3237708.p0 Protein 1e-33 41
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_003923.1003749.p0 Protein 1e-33 41
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_002758.1121668.p0 Protein 1e-33 41
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_009641.5332272.p0 Protein 1e-33 41
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator NC_013450.8614421.p0 Protein 1e-33 41
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator AE016830.1.gene1681. Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator VFG0596 Protein 2e-58 56
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator VFG1390 Protein 1e-37 43
cusR YP_001942028.1 two-component system copper resistance phosphate regulon response regulator VFG1389 Protein 3e-31 42