Gene Information

Name : Desca_0867 (Desca_0867)
Accession : YP_004496658.1
Strain : Desulfotomaculum carboxydivorans CO-1-SRB
Genome accession: NC_015565
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 958754 - 959461 bp
Length : 708 bp
Strand : +
Note : KEGG: hmo:HM1_2078 transcriptional regulatory protein; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduction r

DNA sequence :
ATGGCTAAGATTCTGGTAGTAGATGATGAAACCAATATTCTCGAGTTAATCAAATATAATTTGGAAAAAGACAATCACCG
GGTCATTACTGCCTTGGACGGGGAAGAGGGCTTACGTTTAGCCCAACAAGAGCCACCGGACTTAATTATACTTGATGTTA
TGTTACCAAAAGTGGATGGTTTGGAGGTATGCCGATGTTTGCGCAGTCACCCCTCCACATCAAGACTGCCCATATTAATG
GTTTCTGCCAGGAGAGAGACGGTGGACCATGTTGTGGGACTGGAAATGGGTGCCGATGACTATATTACCAAGCCCTTTAG
CCCCAGAGAGTTGGCCGCCAGAGTGAAGGCCAACCTCCGGCGTGCACAATATGATAAACTTGTTGCATCCAATACTTCCT
TAATTAGAGTAGGTGGTTTGGAAATGAATTTGGATAAATTTGAAGTGCATGTAGAAGGAACACCGGTCAATTTTACCCCG
AAAGAGTTTAAGCTACTCCATGTCCTAATGTCTCATCCGGGTAAAGTATTTACCAGAGAAATGCTGCTTGAACAGGTGTG
GGGATTTGACAATAACGTAGATACCCGTACAGTTGATGTGCATATCCGCTATGTGCGCCAAAAGATTGAAGTTGATCCGG
GTAATCCTAAATATATTTTAACGGTTCGTGGTGTAGGATATAAATTTTCGGAGGATTATAAATGTTAA

Protein sequence :
MAKILVVDDETNILELIKYNLEKDNHRVITALDGEEGLRLAQQEPPDLIILDVMLPKVDGLEVCRCLRSHPSTSRLPILM
VSARRETVDHVVGLEMGADDYITKPFSPRELAARVKANLRRAQYDKLVASNTSLIRVGGLEMNLDKFEVHVEGTPVNFTP
KEFKLLHVLMSHPGKVFTREMLLEQVWGFDNNVDTRTVDVHIRYVRQKIEVDPGNPKYILTVRGVGYKFSEDYKC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-40 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-40 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-48 52
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-51 50
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-51 50
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-51 50
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-51 50
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-51 50
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-51 50
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-51 50
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-51 50
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-51 50
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-52 50
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-51 49
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-48 48
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 6e-47 48
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-39 45
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-40 44
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-39 43
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-39 43
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-39 43
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-39 43
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-39 43
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-39 43
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-39 43
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-39 43
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-35 43
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-37 43
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-31 43
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-35 42
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 7e-33 42
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 3e-38 42
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 6e-34 41
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 6e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator VFG1389 Protein 6e-33 46
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-40 44
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-38 42
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-40 42
Desca_0867 YP_004496658.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-33 41