Gene Information

Name : Desde_0924 (Desde_0924)
Accession : YP_006429154.1
Strain : Desulfitobacterium dehalogenans ATCC 51507
Genome accession: NC_018017
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 937494 - 938291 bp
Length : 798 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGGGAGGTTATCCCAAGGTTTTCAGCCAATTTTCAGTCAGCCCTCAGACCCATTTCAACTGGGCAGCAGATAATGAGAA
GAAAACGATTTCGCCTTTAAAGGGGATATACTCTATGCAGAAGTTGAAAGGAATCAAAATCCTTATTATTGATGACGAAC
CGAATATTCTGGAGTTCCTGGAAATGGGATTGCTGAACGAGGGCTTCGAGGTGCAGACAGCGGCTGATGGGATGACAGGA
GTTACTCTAGCCAAACAATTCCATCCCCACCTCGTGATTCTGGATATCATGATGCCGGGGATGGATGGTTTTGAAGTGTG
TCGTATGCTGAAGAAGAGTGAGAATGTGTCCATCATTATGTTGACTGCTAAGGATGAAGTGGAGGACCGGGTCAAGGGCT
TAACCATCGGCGCCGACGATTATATGGCCAAGCCCTTTAGTTTTGAAGAACTCCTCGCTCGAATCCACGCCCGTATCCGC
AATCAGTTCCCTACCCTTTTAGGGGAAGTGGTGATGGGGCCATTTCGTTTGGATGATCGCCGCAAGGAAATCCAGCTTCA
TGATAAAGTCCTGGAACTTTCCCCGACAGAGTATGAACTGCTCAAGTTTTTAATTCTTAACCAGGGGCTGGTCTTGAGCA
AGGCGATGATTCTGGATAAAGTGTGGGGATATGATTTTGTCGGGGATGATAATATTGTGGAGGTCTATATTCGCTCCCTG
AGAGAAAAGCTGGGGGATAAGGAACATCGCCTGATTCGCACATTGCGGGGCTCCGGCTATCGGATGGACCTACTATGA

Protein sequence :
MGGYPKVFSQFSVSPQTHFNWAADNEKKTISPLKGIYSMQKLKGIKILIIDDEPNILEFLEMGLLNEGFEVQTAADGMTG
VTLAKQFHPHLVILDIMMPGMDGFEVCRMLKKSENVSIIMLTAKDEVEDRVKGLTIGADDYMAKPFSFEELLARIHARIR
NQFPTLLGEVVMGPFRLDDRRKEIQLHDKVLELSPTEYELLKFLILNQGLVLSKAMILDKVWGYDFVGDDNIVEVYIRSL
REKLGDKEHRLIRTLRGSGYRMDLL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-38 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 3e-37 44
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene2815. Protein 7e-38 44
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 2e-37 43
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 2e-37 43
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 3e-37 43
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 3e-37 43
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 3e-37 43
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 3e-37 43
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 3e-37 43
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 3e-37 43
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 3e-37 43
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 8e-31 41
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 4e-35 41
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 4e-35 41
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 4e-35 41
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 4e-35 41
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 4e-35 41
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 4e-35 41
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 4e-35 41
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 4e-35 41
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0083 Protein 3e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1386 Protein 9e-39 45
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 2e-38 42
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 4e-36 42
Desde_0924 YP_006429154.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 2e-32 41