Gene Information

Name : cusR (BMULJ_00904)
Accession : YP_001945393.1
Strain :
Genome accession: NC_010804
Putative virulence/resistance : Virulence
Product : two-component system copper resistance phosphate regulon response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 977762 - 978445 bp
Length : 684 bp
Strand : +
Note : COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain, Ralstonia solanacearum; CusR protein; KEGG, K07665

DNA sequence :
ATGAAACTGTTGGTGATCGAGGACGAGAACAAGACAGCGGACTACGTGCGCCAGGGCCTCATGGAAGCGGGGTTCGTGGT
GGACCTGGCACGCAATGGCCTGGACGGCCATCACCAGGCCATGAGCGAGACCTACGATCTGGTCATCCTCGACGTCATGC
TGCCGGACGTGGATGGCTGGCGCATCGTTCAATCGCTGCGCGAGGCGGGCAAGCAGGTCCCGGTGCTGTTCCTGACCGCG
CGCGGCGGCGTGGATGACCGCGTGAAGGGCCTGGAACTGGGCGCCGACGACTACCTGGTCAAGCCTTTCGCGTTCTCCGA
GTTGCTCGCGCGCGTGCGCACGCTGCTGCGCCGCGGCAGCGCGCCCAACCACCCCGACCGCATCCAGATCGCCGATCTGC
TGCTCGACCTGCCGCGGCGGCGCGCGACCCGGGCAGGACAGCGCATCAACCTAACCAGCAAGGAGTTCGCCTTGCTCGAA
CTGCTGGCGCGGCGCCAGGGCGAGGTGTTGCCGCGCTCATTGATCGCCTCGCAGGTCTGGGACATGAATTTCGACAGCGA
CAGCAACGTGATCGACGTTGCCATTCGCCGGCTGCGCGCGAAGATCGACGATGCCTTCGATCCCAAGCTCATCCATACGG
TACGGGGCATGGGCTATACGCTGGATGCCCCGGATGCCGACTAA

Protein sequence :
MKLLVIEDENKTADYVRQGLMEAGFVVDLARNGLDGHHQAMSETYDLVILDVMLPDVDGWRIVQSLREAGKQVPVLFLTA
RGGVDDRVKGLELGADDYLVKPFAFSELLARVRTLLRRGSAPNHPDRIQIADLLLDLPRRRATRAGQRINLTSKEFALLE
LLARRQGEVLPRSLIASQVWDMNFDSDSNVIDVAIRRLRAKIDDAFDPKLIHTVRGMGYTLDAPDAD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-57 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-56 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_001945393.1 two-component system copper resistance phosphate regulon response regulator BAC0083 Protein 2e-69 72
cusR YP_001945393.1 two-component system copper resistance phosphate regulon response regulator BAC0111 Protein 4e-72 69
cusR YP_001945393.1 two-component system copper resistance phosphate regulon response regulator BAC0638 Protein 1e-62 69
cusR YP_001945393.1 two-component system copper resistance phosphate regulon response regulator BAC0197 Protein 5e-62 65
cusR YP_001945393.1 two-component system copper resistance phosphate regulon response regulator BAC0347 Protein 6e-63 64
cusR YP_001945393.1 two-component system copper resistance phosphate regulon response regulator BAC0125 Protein 1e-60 62
cusR YP_001945393.1 two-component system copper resistance phosphate regulon response regulator BAC0308 Protein 2e-62 61
cusR YP_001945393.1 two-component system copper resistance phosphate regulon response regulator NC_002516.2.879194.p Protein 4e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_001945393.1 two-component system copper resistance phosphate regulon response regulator VFG0596 Protein 1e-57 58
cusR YP_001945393.1 two-component system copper resistance phosphate regulon response regulator VFG1389 Protein 3e-34 45
cusR YP_001945393.1 two-component system copper resistance phosphate regulon response regulator VFG1390 Protein 8e-39 43