Gene Information

Name : pipB (SEN0952)
Accession : YP_002243083.1
Strain : Salmonella enterica P125109
Genome accession: NC_011294
Putative virulence/resistance : Virulence
Product : pathogenicity island protein
Function : -
COG functional category : S : Function unknown
COG ID : COG1357
EC number : -
Position : 1054298 - 1055173 bp
Length : 876 bp
Strand : -
Note : -

DNA sequence :
ATGCCAATAACTAACGCGTCCCCAGAAAATATATTAAGATATTTGCATGCGGCCGGTACCGGTACGAAAGAAGCAATGAA
AAGTGCAACTTCACCACGCGGTATACTGGAATGGTTTGTCAATTTTTTTACCTGTGGTGGAGTAAGAAGAAGCAATGAAA
GATGCTTTCAGGAGGTAATTGGAAAACTGACCACATCATTATTATATGTAAATAAAGATGCTTTCTTCGATGGTAATAAA
ATATTTCTGGAGGATGTCAACGGGTGTACTATATGTCTGTCATGTGGAGCAGCATCCGAAAATACGGCTCCCATGGTCAT
TATTGAAGTGAACAAAAATGGAAAAACTGTAACGGATAAAGTTGATAGTGAGAGATTTTGGAATGTATGCCGAATGTTAA
AGCTGATGAGTAAACATAATATACAACAGCCTGATTCACTTATAACCGAGGATGGTTTTCTGAACCTGCGCGGAGTAAAT
CTGGCTCATAAAGATTTCCAGGGGGAAGATTTGTCAGACATAGATGCTTCTGATGCAGATTTCCGTGAAACAACTCTATC
TAATGTAAATTTAGTCGGTGCAAATTTGTGTTGTGCAAATCTACACGCTGTAAATCTAATGGGTTCAAACATGACTAAAG
CAAACCTGACTCACGCAAACCTGACTTGCGCTAACATGTCCGGTGTAAACTTAACCGCTGCAATTCTATTCGGCTCAGAC
TTAACTGACACCAAACTAAATGGTGCGAAATTAGATAAGATAGCTCTAACTTTAGCGAAATCATTAACAGGAGCCGATCT
GACAGGTAGTCAACATACCCCTACTCCACTCCCGGATTACAATGATAGAACTCTTTTCCCCCATCCGATATTTTAG

Protein sequence :
MPITNASPENILRYLHAAGTGTKEAMKSATSPRGILEWFVNFFTCGGVRRSNERCFQEVIGKLTTSLLYVNKDAFFDGNK
IFLEDVNGCTICLSCGAASENTAPMVIIEVNKNGKTVTDKVDSERFWNVCRMLKLMSKHNIQQPDSLITEDGFLNLRGVN
LAHKDFQGEDLSDIDASDADFRETTLSNVNLVGANLCCANLHAVNLMGSNMTKANLTHANLTCANMSGVNLTAAILFGSD
LTDTKLNGAKLDKIALTLAKSLTGADLTGSQHTPTPLPDYNDRTLFPHPIF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
pipB AAC33725.1 PipB Virulence SPI-5 Protein 1e-130 98
pipB NP_460061.1 secreted effector protein Virulence SPI-5 Protein 2e-129 98
pipB YP_216027.1 pathogenicity island encoded protein: SPI3 Virulence SPI-5 Protein 9e-130 98
pipB NP_455586.1 conserved hypothetical protein Virulence SPI-5 Protein 7e-130 98

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pipB YP_002243083.1 pathogenicity island protein VFG0589 Protein 9e-130 98