Gene Information

Name : copS (SEN0959)
Accession : YP_002243089.1
Strain : Salmonella enterica P125109
Genome accession: NC_011294
Putative virulence/resistance : Virulence
Product : histidine kinase
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0642
EC number : -
Position : 1060128 - 1061492 bp
Length : 1365 bp
Strand : -
Note : -

DNA sequence :
ATGGTTAAGTTATCAATGACGCTGCGCCTGACAATTTCTTTTATCGCCATCCTTATCCTCGCCTGTACCGGCATTAGCTG
GACGCTCTATAACGCGCTGAGCAAAGAATTAACGTATCGTGATGATATGACGCTAATAAATCGGGCGGCGCAAATGCAGC
AACTGTTACTGGATGGCGCCAGGCCGGAAAATCTGCCGCTCTATTTCAATCGGATGGTGGATACGAAGCAGGATATCTTA
TTGATCCATTCAGCAACAGGCCACAATGTTGCGATTAATCATAGCGGCATCCCCGACCAACGCTTTAACGAGATTCCGCT
GGCTAAAAACATCACCCGCGAAACCTTATTTCGCCAGGCGGTACAAGGCACGGAACTTACCGCGGTACGAGTAAACGCCA
GAAGCGGCGATGACCCGCTGACCCTTACTATTGCCAGGCTGGCGACGGAAAGGCGGCAAATGCTGACGCAATATCGCCGC
AACAGTTTGCTGATGAGCCTTATCGCGATCCTCGTCTGTTCGGCGCTCAGTCCATTAGTCATCAGAAACGGGCTGCGGGC
CATTACGTCGCTCAGCCGACTCACCGCGGCGACAGATAGCGGCACACTTCGCCAGCCGTTGGCGGAACAGGCGTTACCCG
TTGAGCTCAGGCCGCTTGGACAAGCGCTAAATACCATGCGCCAGAAGCTTTCCGACGATTTTGAACGCCTGAACCAATTT
GCCGACGATCTGGCGCATGAGCTGCGCACGCCGGTTAATATTTTACTGGGGAAGAATCAGGTGATGCTGAGTCAGGAACG
CAGCGCCGAAGAGTATCAACAAGCCCTTGTCGATAATATTGAAGAGCTGGAGGGACTGTCGCGACTGACAGAAAATATTC
TCTTTCTGGCACGCGCGGAGCACCAGAATATAGCGGTAAAAAAACAGCCTGTTTCGCTCAATGCGCTGGTCGAAAATATG
CTGGATTATCTTAGCCCCCTTGCCGAGGAGAAGCGCATCTGTTTTATAAATCAATGTCAGGGAACGGTATGGGCTGACGA
AATATTATTACAAAGAGTGCTCTCAAACCTGCTGACGAATGCCATCCGTTATTCTGATGAAAACGCCGTGATACGTATTG
AAAGCGCTTATGATGATAACGTTGCAGAAATTCGGGTCGCTAATCCGGGCAGCCACCCAGCCGATGCGGATAAGCTTTTC
CGGCGTTTTTGGCGAGGAGATAATGCCCGCCACACTGCCGGTTTCGGCCTGGGGTTATCGTTAGTTAACGCGATTGCTCT
ATTACACGGTGGTTCGGCATCTTACCGCTATGCCGATGAACATAATATCTTTTCGGTTCGTCTGCCCGATAGCGGTGATA
GCTAA

Protein sequence :
MVKLSMTLRLTISFIAILILACTGISWTLYNALSKELTYRDDMTLINRAAQMQQLLLDGARPENLPLYFNRMVDTKQDIL
LIHSATGHNVAINHSGIPDQRFNEIPLAKNITRETLFRQAVQGTELTAVRVNARSGDDPLTLTIARLATERRQMLTQYRR
NSLLMSLIAILVCSALSPLVIRNGLRAITSLSRLTAATDSGTLRQPLAEQALPVELRPLGQALNTMRQKLSDDFERLNQF
ADDLAHELRTPVNILLGKNQVMLSQERSAEEYQQALVDNIEELEGLSRLTENILFLARAEHQNIAVKKQPVSLNALVENM
LDYLSPLAEEKRICFINQCQGTVWADEILLQRVLSNLLTNAIRYSDENAVIRIESAYDDNVAEIRVANPGSHPADADKLF
RRFWRGDNARHTAGFGLGLSLVNAIALLHGGSASYRYADEHNIFSVRLPDSGDS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copS AAC33720.1 histidine kinase Not tested SPI-5 Protein 0.0 99
copS NP_460068.1 copper resistance protein Not tested SPI-5 Protein 0.0 99

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copS YP_002243089.1 histidine kinase VFG0595 Protein 0.0 99