PAI Gene Information


Name : irp2
Accession : AAA61575.1
PAI name : HPI
PAI accession : U19396
Strain : Yersinia pestis A1122
Virulence or Resistance: Virulence
Product : high-molecular-weight protein 2 homolog
Function : -
Note : similar to Yersinia enterocolitica high-molecular-weight protein 2, PIR Accession Number A48654
Homologs in the searched genomes :   No hits  
Publication :
    -Fetherston,J.D., "Analysis of the pesticin receptor from Yersinia pestis: role in iron-deficient growth and possible regulation by its siderophore", Unpublished.

    -Fetherston,J.D., "Direct Submission", Submitted (04-JAN-1995) Jacqueline D. Fetherston, Microbiology and Immunology, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0084, USA.

    -Guilvout,I., Mercereau-Puijalon,O., Bonnefoy,S., Pugsley,A.P. and Carniel,E., "High-molecular-weight protein 2 of Yersinia enterocolitica is homologous to AngR of Vibrio anguillarum and belongs to a family of proteins involved in nonribosomal peptide synthesis", J. Bacteriol. 175 (17), 5488-5504 (1993) PUBMED 8366034.


DNA sequence :
GATCTCCGCAGAACAGGTAGCCGATTTCCTTCAGCATCGCCTCGTAAAACTGAAGCCGGGTCACACCGCTGGCGCCGATC
CTCTCCCCCTGATGAACTCACTCGCTATCCAGCCGCNCTGGCAGGCCGTNGTGGAACNCTGGTTAGCATTTCTGGTGACA
CAACGGCGACTGAAGCCCGCTGCTGAAGGTTATCAGGTCTGCGCTGGTGAAGAACGCGAGGATGAGCACCCGCACTTCAG
CGGACATGATTTAACGTTATCGCAAATTCTTCGCGGTGCCCGTAACGAACTGTCGTTACTGAACGACGCGCAGTGGT

Protein sequence :
ISAEQVADFLQHRLVKLKPGHTAGADPLPLMNSLAIQPXWQAVVEXWLAFLVTQRRLKPAAEGYQVCAGEEREDEHPHFS
GHDLTLSQILRGARNELSLLNDAQW