PAI Gene Information


Name : vapA
Accession : AAB00943.1
PAI name : vap locus
PAI accession : L31763
Strain : Dichelobacter nodosus VCS1703A
Virulence or Resistance: Virulence
Product : virulence-associated protein A
Function : -
Note : putative
Homologs in the searched genomes :   70 hits    ( 70 protein-level )  
Publication :
    -Cheetham,B.F., Tattersall,D.B., Bloomfield,G.A., Rood,J.I. and Katz,M.E., "Identification of a gene encoding a bacteriophage-related integrase in a vap region of the Dichelobacter nodosus genome", Gene 162 (1), 53-58 (1995) PUBMED 7557417.

    -Katz,M.E., Howarth,P.M., Yong,W.K., Riffkin,G.G., Depiazzi,L.J. and Rood,J.I., "Identification of three gene regions associated with virulence in Dichelobacter nodosus, the causative agent of ovine footrot", J. Gen. Microbiol. 137 (Pt 9), 2117-2124 (1991) PUBMED 1748867.

    -Katz,M.E., Howarth,P.M., Yong,W.K., Riffkin,G.G., Depiazzi,L.J. and Rood,J.I., "Direct Submission", Submitted (16-OCT-2008) Department of Microbiology, Monash University, Clayton, Victoria, Australia.

    -Katz,M.E., Wright,C.L., Gartside,T.S., Doidge,C.V., Moses,E.K. and Rood,J.I., "Genetic organization of the duplicated vap region of the dichelobacter nodosus genome", Unpublished.


DNA sequence :
ATGGCAAAAATGAAAAATCCACCGCACCCCGGTTTAATGCTGAAAGTCATGTATTTGGAACCATTGGGGCTCAACATTAC
GGAAACCGCGGAAAAGCTGGATATGCCGCGTTCTGCTTTATCTGAAATTGTAAACGCCAAACGCGCAATTAGTCCTGAAG
TCGCGGTGAAGCTAGAAAAAGCCTTCCCCAAACATTCGGCTTCTTTTTGGTTACGGGCTCAGGCAGGATATGCATTGTCG
CGCGTCAATCCCCATTGTGCCGATAAAGTGAAACCCATTAAAACTTCTCCCCTGATGGAGTCCGTATAA

Protein sequence :
MAKMKNPPHPGLMLKVMYLEPLGLNITETAEKLDMPRSALSEIVNAKRAISPEVAVKLEKAFPKHSASFWLRAQAGYALS
RVNPHCADKVKPIKTSPLMESV