PAI Gene Information


Name : unnamed
Accession : AAC38365.1
PAI name : LEE
PAI accession : AF022236
Strain : Escherichia coli 042
Virulence or Resistance: Not determined
Product : Orf2
Function : -
Note : -
Homologs in the searched genomes :   12 hits    ( 12 protein-level )  
Publication :
    -Elliott,S.J. and Kaper,J.B., "Direct Submission", Submitted (19-FEB-1998) Center for Vaccine Development, University of Maryland School of Medicine, 685 W Baltimore St, Baltimore, MD 21201, USA REMARK Sequence update by submitter.

    -Elliott,S.J., Wainwright,L.A., McDaniel,T.K., Jarvis,K.G., Deng,Y.K., Lai,L.C., McNamara,B.P., Donnenberg,M.S. and Kaper,J.B., "The complete sequence of the locus of enterocyte effacement (LEE) from enteropathogenic Escherichia coli E2348/69", Mol. Microbiol. 28 (1), 1-4 (1998) PUBMED 9593291.

    -Elliott,S.J., Wainwright,L.A., McDaniel,T.K., Jarvis,K.G., Deng,Y.K., Lai,L.C., McNamara,B.P., Donnenberg,M.S. and Kaper,J.B., "Direct Submission", Submitted (03-SEP-1997) Center for Vaccine Development, University of Maryland School of Medicine, 685 W Baltimore St, Baltimore, MD 21201, USA.

    -McNamara,B.P. and Donnenberg,M.S., "Direct Submission", Submitted (05-MAR-1998) University of Maryland School of Medicine, 685 W Baltimore St, Baltimore, MD 21201, USA REMARK update of Orf30 to EspF submitted by B.P. McNamara and M.S. Donnenberg.

    -O'Connell,C. and Donnenberg,M.S., "Direct Submission", Submitted (05-MAR-1998) University of Maryland School of Medicine, 685 W Baltimore St, Baltimore, MD 21201, USA REMARK update of Orf23 to SepL submitted by C. O'Connell and M.S. Donnenberg.


DNA sequence :
ATGATAACGATAACTGAGCTGGAAGACGAAATAATAAAAAATAAAGAAGCCGCAAATGTTTTTATTGAAAAAATAAACGA
CAAAAAGAACGAAATCCATGAAAAAATGAAACACCCTTTGGATAAAGTTACCTACAATGAAGCAAAGGAACTGCTCATTG
CGTGTGATGCGGCAATTAGGACTATAGAGATAATGCGAATCAGGATTAATAATAAATAG

Protein sequence :
MITITELEDEIIKNKEAANVFIEKINDKKNEIHEKMKHPLDKVTYNEAKELLIACDAAIRTIEIMRIRINNK