Name : papB
Accession : AAC61719.1
PAI name : PAI I CFT073
PAI accession : AF081285
Strain : Escherichia coli 042
Virulence or Resistance: Virulence
Product : PapB
Function : -
Note : P-pilus F13
Homologs in the searched genomes : 37 hits ( 37 protein-level )
Publication :
-Guyer,D.M., Kao,J.S. and Mobley,H.L., "Genomic analysis of a pathogenicity island in uropathogenic Escherichia coli CFT073: distribution of homologous sequences among isolates from patients with pyelonephritis, cystitis, and Catheter-associated bacteriuria and from fecal samples", Infect. Immun. 66 (9), 4411-4417 (1998) PUBMED 9712795.
-Guyer,D.M., Kao,J.S. and Mobley,H.L.T., "Direct Submission", Submitted (02-AUG-1998) Microbiology and Immunology, University of Maryland at Baltimore, 655 W. Baltimore St. Rm. 13-009, Baltimore, MD 21201, USA.
-Kao,J.S., Stucker,D.M., Warren,J.W. and Mobley,H.L., "Pathogenicity island sequences of pyelonephritogenic Escherichia coli CFT073 are associated with virulent uropathogenic strains", Infect. Immun. 65 (7), 2812-2820 (1997) PUBMED 9199454.
| DNA sequence : | |
ATGGCGCATCATGAAGTCATCAGTCGGTCAGGAAATGCGTTTTTGCTGAATATACGCGAGAGCGTACTGTTGCCCGGGTC
TATGTCTGAAATGCATTTTTTTTTACTGATAGGTATTTCTTCTATTCACAGTGACAGGGTCATTCTGGCTATGAAGGACT
ATCTGGTAGGTGGGCACTCCCGTAAGGAGGTCTGCGAGAAATACCAGATGAATAATGGGTATTTCAGTACAACACTGGGG
AGACTTATACGGCTGAATGCTCTTGCAGCAAGGCTTGCACCTTATTATACAGATGAGTCCTCGGCATTTGACTAA
|
| Protein sequence : | |
MAHHEVISRSGNAFLLNIRESVLLPGSMSEMHFFLLIGISSIHSDRVILAMKDYLVGGHSRKEVCEKYQMNNGYFSTTLG
RLIRLNALAARLAPYYTDESSAFD
|
|