PAI Gene Information


Name : E3
Accession : AAD21327.1
PAI name :
PAI accession : AF056246
Strain :
Virulence or Resistance: Not determined
Product : E3
Function : -
Note : -
Homologs in the searched genomes :   1 hits    ( 1 protein-level )  
Publication :
    -Huguet,E., "Direct Submission", Submitted (21-NOV-1996) CNRS, ISV, Ave. de La Terrasse, Gif-sur-Yvette 91198, France.

    -Huguet,E. and Bonas,U., "hrpF of Xanthomonas campestris pv. vesicatoria", Unpublished.

    -Huguet,E., Hahn,K., Wengelnik,K. and Bonas,U., "hpaA mutants of Xanthomonas campestris pv. vesicatoria are affected in pathogenicity but retain the ability to induce host-specific hypersensitive reaction", Mol. Microbiol. 29 (6), 1379-1390 (1998) PUBMED 9781876.

    -Huguet,E.J., Hahn,K., Wengelnik,K. and Bonas,U., "Direct Submission", Submitted (30-MAR-1998) CNRS, ISV, Ave. de La Terrasse, Gif-sur-Yvette 91198, France.

    -Noel,L., Thieme,F., Nennstiel,D. and Bonas,U., "Two novel type III-secreted proteins of Xanthomonas campestris pv. vesicatoria are encoded within the hrp pathogenicity island", J. Bacteriol. 184 (5), 1340-1348 (2002) PUBMED 11844763.

    -Noel,L., Thieme,F., Nennstiel,D. and Bonas,U., "Direct Submission", Submitted (06-AUG-2001) Institut fuer Genetik, Martin-Luther-University Halle-Wittenberg, Weinberg 10, Halle D-06099, Germany REMARK Sequence update by submitter.


DNA sequence :
ATGGCACAGCAACTTGGCTTGCCGGCCAACTCCGCCGGCCTGGCACTCCTCTGCCCGATGGCGCCGGTGGCGCTGAGTGA
AACCCACTTGGCGATGTCGAAGCCTGACACGCGTGCATCTGCGCTGGCTTGCTCCCCGATACAGGTTTGGCGGGAGATCG
CAGGTCTGTCGTGCCGGCTCACCGCGATGGCCGACACTGCACAGAACAAGGGCAGGCGCAGACTCATGGTCTACACCGTG
CACACCCGCGACGGCAGCTGA

Protein sequence :
MAQQLGLPANSAGLALLCPMAPVALSETHLAMSKPDTRASALACSPIQVWREIAGLSCRLTAMADTAQNKGRRRLMVYTV
HTRDGS