PAI Gene Information


Name : hrpP
Accession : AAG33881.1
PAI name : Hrp PAI
PAI accession : AF232004
Strain : Pseudomonas syringae 1448A
Virulence or Resistance: Virulence
Product : HrpP
Function : -
Note : likely involved in type III protein secretion
Homologs in the searched genomes :   3 hits    ( 3 protein-level )  
Publication :
    -Alfano,J.R. and Collmer,A., "Direct Submission", Submitted (07-FEB-2000) Dept. Biol. Sci., UNLV, 1854 Maryland Parkway, Las Vegas, NV 89154, USA.

    -Alfano,J.R., Charkowski,A.O., Deng,W.L., Badel,J.L., Petnicki-Ocwieja,T., van Dijk,K. and Collmer,A., "The Pseudomonas syringae Hrp pathogenicity island has a tripartite mosaic structure composed of a cluster of type III secretion genes bounded by exchangeable effector and conserved effector loci that contribute to parasitic fitness and pathogenicity in pl", Proc. Natl. Acad. Sci. U.S.A. 97 (9), 4856-4861 (2000) PUBMED 10781092.

    -Charkowski,A.O., Alfano,J.R., Preston,G., Yuan,J., He,S.Y. and Collmer,A., "The Pseudomonas syringae pv. tomato HrpW protein has domains similar to harpins and pectate lyases and can elicit the plant hypersensitive response and bind to pectate", J. Bacteriol. 180 (19), 5211-5217 (1998) PUBMED 9748456.

    -Deng,W.L., Preston,G., Collmer,A., Chang,C.J. and Huang,H.C., "Characterization of the hrpC and hrpRS operons of Pseudomonas syringae pathovars syringae, tomato, and glycinea and analysis of the ability of hrpF, hrpG, hrcC, hrpT, and hrpV mutants to elicit the hypersensitive response and disease in plants", J. Bacteriol. 180 (17), 4523-4531 (1998) PUBMED 9721291.

    -Fouts,D.E., Badel,J.L., Ramos,A.R., Rapp,R.A. and Collmer,A., "A pseudomonas syringae pv. tomato DC3000 Hrp (Type III secretion) deletion mutant expressing the Hrp system of bean pathogen P. syringae pv. syringae 61 retains normal host specificity for tomato", Mol. Plant Microbe Interact. 16 (1), 43-52 (2003) PUBMED 12580281.

    -Preston,G., Huang,H.C., He,S.Y. and Collmer,A., "The HrpZ proteins of Pseudomonas syringae pvs. syringae, glycinea, and tomato are encoded by an operon containing Yersinia ysc homologs and elicit the hypersensitive response in tomato but not soybean", Mol. Plant Microbe Interact. 8 (5), 717-732 (1995) PUBMED 7579616.

    -Ramos,A.R., Rehm,A.H. and Collmer,A.R., "Pseudomonas syringae pv. tomato DC3000 hrpL through hrcU", Unpublished.

    -Ramos,A.R., Rehm,A.H. and Collmer,A.R., "Direct Submission", Submitted (22-NOV-2000) Plant Pathology, Cornell University, 334 Plant Sciences Bldg., Ithaca, NY 14850, USA REMARK Sequence update by submitter.

    -Ramos,A.R., Rehm,A.H. and Collmer,A.R., "Direct Submission", Submitted (05-MAR-2001) Plant Pathology, Cornell University, 334 Plant Sciences Bldg., Ithaca, NY 14850, USA REMARK Sequence update by submitter.


DNA sequence :
ATGACCGCACCGATCAAAACCCCGGCCAAAGCGCCACCAGCACCCCAGCGCCCTGCGCCTGTCGAGCGGCCAGCCACAGC
TCTTAGCGAAAAACCATTCGGTGAAAAACGCCCTGCATCCGGTGGCCTGGGCCGTGGCGATGTACAGACCAGCCGTTCGG
TACTGAGCAAGTCGCTGCAAGACACCCCGATGAGTGCCGACGGCATGTTCTTTTCGCAACTGCTGGTGCCGCCCGTAAGT
GCCGAACCTGGTCAGCAAGGCTTTGGCGGGGGCGGTATAGCCTTTCCGGTACGCGCAGAACAAGTGCCGACCCAACTGAT
CGACGAGCTGGCGCAGCGCCTGCCGGATCAGCCTGACGGCCCCCTCAGTTTCACCCTGCTGATGCCCAGCCTGGGCAGCG
TTCGGGTCAATGCCAACAAAACCGAAAACCGCTGGAGCGTGCAGTTGGGCTTTGCCCGCCGCGATGTACTCAAGCGTCTG
AGTGCCCATACGGGCGCATGCCGCGACTCGCTGTCACAAGCGCTTGGGCAGGACGTTGAGCTGGACATGCATGAAGACCT
TTCAGCATGA

Protein sequence :
MTAPIKTPAKAPPAPQRPAPVERPATALSEKPFGEKRPASGGLGRGDVQTSRSVLSKSLQDTPMSADGMFFSQLLVPPVS
AEPGQQGFGGGGIAFPVRAEQVPTQLIDELAQRLPDQPDGPLSFTLLMPSLGSVRVNANKTENRWSVQLGFARRDVLKRL
SAHTGACRDSLSQALGQDVELDMHEDLSA