PAI Gene Information


Name : unnamed
Accession : AAK15327.1
PAI name : Not named
PAI accession : AF332547
Strain : Pseudomonas aeruginosa B136-33
Virulence or Resistance: Not determined
Product : unknown
Function : -
Note : OrfB; similar to the putative acyl carrier protein of Campylobacter jejuni
Homologs in the searched genomes :   27 hits    ( 27 protein-level )  
Publication :
    -Arora,S.K., Bangera,M., Lory,S. and Ramphal,R., "A genomic island in Pseudomonas aeruginosa carries the determinants of flagellin glycosylation", Proc. Natl. Acad. Sci. U.S.A. 98 (16), 9342-9347 (2001) PUBMED 11481492.

    -Arora,S.K., Lory,S. and Ramphal,R., "Direct Submission", Submitted (28-DEC-2000) Medicine/Infectious Diseases, University of Florida, R2-148, ARB Building, 1600 SW Archer Road, Gainesville, FL 32610, USA.

    -Schirm,M., Arora,S.K., Verma,A., Vinogradov,E., Thibault,P., Ramphal,R. and Logan,S.M., "Structural and genetic characterization of glycosylation of type a flagellin in Pseudomonas aeruginosa", J. Bacteriol. 186 (9), 2523-2531 (2004) PUBMED 15090491.

    -Verma,A., Schirm,M., Arora,S.K., Thibault,P., Logan,S.M. and Ramphal,R., "Glycosylation of b-Type flagellin of Pseudomonas aeruginosa: structural and genetic basis", J. Bacteriol. 188 (12), 4395-4403 (2006) PUBMED 16740946.


DNA sequence :
ATGAGCCAAGCAAAATTCATCGAAGACTTCCTTTCCGCCACCGATTTCCAGAATCCCGTCGAGGTCAGCATGGACACCCA
GCTCGAAGACCTGCCGGAATGGGACTCGCTGGCCGCGCTCGGGGTCATCGTCATGTTCGACATGGAATACGGCAAGACCA
TCACCGGCGAAGACCTGATCAAGGCTCGCACGGTGGGCGACCTCTACCAGATGCTCGGACTCTGA

Protein sequence :
MSQAKFIEDFLSATDFQNPVEVSMDTQLEDLPEWDSLAALGVIVMFDMEYGKTITGEDLIKARTVGDLYQMLGL