PAI Gene Information


Name : unnamed
Accession : AAK26697.1
PAI name : LEE
PAI accession : AF200363
Strain : Escherichia coli 042
Virulence or Resistance: Not determined
Product : unknown
Function : -
Note : Orf2
Homologs in the searched genomes :   12 hits    ( 12 protein-level )  
Publication :
    -Agin,T.S., Cantey,J.R., Boedeker,E.C. and Wolf,M.K., "Characterization of the eaeA gene from rabbit enteropathogenic Escherichia coli strain RDEC-1 and comparison to other eaeA genes from bacteria that cause attaching-effacing lesions", FEMS Microbiol. Lett. 144 (2-3), 249-258 (1996) PUBMED 8900070.

    -Boedeker,E.C., Zhu,C., Elliott,S.J., Tonia,T.S., Johnson,L.A., Thate,T.E. and Kaper,J.B., "Direct Submission", Submitted (01-NOV-1999) University of Maryland School of Medicine, Center for Vaccine Development, 685 West Baltimore St., Baltimore, MD 21201, USA.

    -Elliott,S.J., Wainwright,L.A., McDaniel,T.K., Jarvis,K.G., Deng,Y.K., Lai,L.C., McNamara,B.P., Donnenberg,M.S. and Kaper,J.B., "The complete sequence of the locus of enterocyte effacement (LEE) from enteropathogenic Escherichia coli E2348/69", Mol. Microbiol. 28 (1), 1-4 (1998) PUBMED 9593291.

    -Zhu,C., Agin,T.S., Elliott,S.J., Johnson,L.A., Thate,T.E., Kaper,J.B. and Boedeker,E.C., "Complete nucleotide sequence and analysis of the locus of enterocyte Effacement from rabbit diarrheagenic Escherichia coli RDEC-1", Infect. Immun. 69 (4), 2107-2115 (2001) PUBMED 11254564.


DNA sequence :
ATGATAACGATAACTGAACTGGAAGACGAAATAATAAAAAATAAAGAAGCCGCAAATATTTTCATTGAAAAAATAAACGA
CAAAAAGAACGAAATCCATGAAAAAATGAAACACCCCTTGGATAAAGTTACCTACAATGAAGCAAAGGAACTGCTCATTG
CCTGCGATGCGGCAATCAGGATCATAGAGATAATGCTAATCAGAATTAATAATAAATAG

Protein sequence :
MITITELEDEIIKNKEAANIFIEKINDKKNEIHEKMKHPLDKVTYNEAKELLIACDAAIRIIEIMLIRINNK