PAI Gene Information


Name : unnamed
Accession : AAL99259.1
PAI name : LEE
PAI accession : AY082443
Strain : Escherichia coli 042
Virulence or Resistance: Not determined
Product : unknown
Function : -
Note : orfQ
Homologs in the searched genomes :   No hits  
Publication :
    -Tauschek,M., Strugnell,R.A. and Robins-Browne,R.M., "Characterization and evidence of mobilization of the LEE pathogenicity island of rabbit-specific strains of enteropathogenic Escherichia coli", Mol. Microbiol. 44 (6), 1533-1550 (2002) PUBMED 12067342.

    -Tauschek,M., Strugnell,R.A. and Robins-Browne,R.M., "Direct Submission", Submitted (06-MAR-2002) Microbiology and Immunology, The University of Melbourne, Parkville, Victoria 3010, Australia.


DNA sequence :
ATCAAAAATGGCTATAGCAGGAAACAGTTGGCAATTATTTACGATATCGGTATATCGACGATTTATCGTTATCACCCTGT
AGAGGAACTTCAAACTCAAGCTGATTTGTAA

Protein sequence :
MKNGYSRKQLAIIYDIGISTIYRYHPVEELQTQADL