PAI Gene Information


Name : unnamed
Accession : AAO18069.1
PAI name : TTSS locus
PAI accession : AY144116
Strain : Photorhabdus luminescens TTO1
Virulence or Resistance: Not determined
Product : unknown
Function : -
Note : similar to acetate CoA-transferase, beta subunit (atoA)
Homologs in the searched genomes :   No hits  
Publication :
    -Waterfield,N.R. and ffrench-Constant,R.H., "Direct Submission", Submitted (22-AUG-2002) Biology and Biochemistry, University of Bath, Claverton Down, Bath BA2 7AY, UK.

    -Waterfield,N.R., Daborn,P.J. and ffrench-Constant,R.H., "Genomic islands in Photorhabdus", Trends Microbiol. 10 (12), 541-545 (2002) PUBMED 12564983.


DNA sequence :
ATGAATGCTCAACAAGTTATTGCCCACCGCGCTGCTCTCGAACTACAAGACGGCGACGTTGTTAATCTTGGCATCGGCAT
TCCCACGCAAGTCCCGAACTATCTGCCAGATCA

Protein sequence :
MNAQQVIAHRAALELQDGDVVNLGIGIPTQVPNYLPD