PAI Gene Information


Name : rox
Accession : AAR97599.1
PAI name : SHI-1
PAI accession : AF200692
Strain : Shigella flexneri 2002017
Virulence or Resistance: Not determined
Product : regulator of excision
Function : -
Note : Rox; regulator of she PAI excision; putative excisionase
Homologs in the searched genomes :   151 hits    ( 148 protein-level,   3 DNA-level )  
Publication :
    -Al-Hasani,K., Henderson,I.R., Sakellaris,H., Rajakumar,K., Grant,T., Nataro,J.P., Robins-Browne,R. and Adler,B., "The sigA gene which is borne on the she pathogenicity island of Shigella flexneri 2a encodes an exported cytopathic protease involved in intestinal fluid accumulation", Infect. Immun. 68 (5), 2457-2463 (2000) PUBMED 10768931.

    -Al-Hasani,K., Rajakumar,K. and Adler,B., "Direct Submission", Submitted (01-NOV-1999) Microbiology, Monash University, Wellington Road, Clayton, Vic 3800, Australia.

    -Al-Hasani,K., Rajakumar,K., Adler,B. and Sakellaris,H., "Direct Submission", Submitted (16-JAN-2001) Microbiology, Monash University, Wellington Road, Clayton, Vic 3800, Australia REMARK Sequence update by submitter.

    -Al-Hasani,K., Rajakumar,K., Bulach,D., Robins-Browne,R., Adler,B. and Sakellaris,H., "Genetic organization of the she pathogenicity island in Shigella flexneri 2a", Microb. Pathog. 30 (1), 1-8 (2001) PUBMED 11162180.


DNA sequence :
ATGAATACCCCAGTTTCACTGATGGATGACCAGATGGTCGACATGTCGTTTATCACTCAGCTGACCGGCCTGACCGATAA
GTGGTTTTATAAACTCATCAAGCATGGAGCCTTTCCGCCCCCCATCAAACTGGGCCGTAGCTCCCGCTGGCTGAAAAGCG
AAGTGGAAGCCTGGCTGCAGGCGCGTATTGCACAGTCCCGTCCGTAA

Protein sequence :
MNTPVSLMDDQMVDMSFITQLTGLTDKWFYKLIKHGAFPPPIKLGRSSRWLKSEVEAWLQARIAQSRP