PAI Gene Information


Name : unnamed
Accession : ABJ97295.1
PAI name : SaPI2
PAI accession : EF010993
Strain : Staphylococcus aureus 04-02981
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : orf12; similar to RF122 SAB 1900c
Homologs in the searched genomes :   1 hits    ( 1 protein-level )  
Publication :
    -Subedi,A. and Novick,R.P., "Direct Submission", Submitted (18-SEP-2006) Molecular Pathogenesis, Skirball Institute of Biomolecular Medicine, New York Medical Center, 540 First Avenue, New York, NY 10016, USA.

    -Subedi,A., Ubeda,C., Adhikari,R.P., Penades,J.R. and Novick,R.P., "Sequence analysis reveals genetic exchanges and intraspecific spread of SaPI2, a pathogenicity island involved in menstrual toxic shock", Microbiology (Reading, Engl.) 153 (PT 10), 3235-3245 (2007) PUBMED 17906123.


DNA sequence :
ATGGCAAGATTTGTGCAAGGTGTGAGAACTTTGTTAACGCTAATACAAGCTAAAGTTTGTGTTTTTGGCATAGGCCTAAA
AGTTAAGTTTGTTCGCTGTTTGTTCGTGTTATTTTATCGAACTTAA

Protein sequence :
MARFVQGVRTLLTLIQAKVCVFGIGLKVKFVRCLFVLFYRT