PAI Gene Information


Name : orfA
Accession : ACX47959.1
PAI name : SGI1
PAI accession : AY463797
Strain : Salmonella enterica RSK2980
Virulence or Resistance: Not determined
Product : IS1359 transposase; OrfA
Function : -
Note : -
Homologs in the searched genomes :   520 hits    ( 519 protein-level,   1 DNA-level )  
Publication :
    -Levings,R.S. and Partridge,S.R., "Direct Submission", Submitted (12-NOV-2003) Biological Sciences, Macquarie University, Sydney NSW 2109, Australia.

    -Levings,R.S. and Partridge,S.R., "Direct Submission", Submitted (14-DEC-2004) Biological Sciences, Macquarie University, Sydney NSW 2109, Australia REMARK Nucleotide sequence updated by submitter.

    -Levings,R.S., Djordjevic,S.P. and Hall,R.M., "SGI1-K includes tetA(A), strAB and blaTEM in segments derived from Tn1721, Tn5393 and Tn2", Unpublished.

    -Levings,R.S., Djordjevic,S.P. and Hall,R.M., "Direct Submission", Submitted (01-NOV-2006) Department of Primary Industries, Elizabeth Macarthur Agricultural Institute, Camden NSW 2570, Australia REMARK Sequence update by submitter.

    -Levings,R.S., Djordjevic,S.P. and Hall,R.M., "Direct Submission", Submitted (11-DEC-2008) NSW Department of Primary Industries, Elizabeth Macarthur Agricultural Institute, PMB 8, Camden NSW 2570, Australia REMARK Sequence update by submitter.

    -Levings,R.S., Partridge,S.R., Djordjevic,S.P. and Hall,R.M., "SGI1-K, a variant of the SGI1 genomic island carrying a mercury resistance region, in Salmonella enterica serovar Kentucky", Antimicrob. Agents Chemother. 51 (1), 317-323 (2007) PUBMED 17088481.

    -Levings,R.S., Partridge,S.R., Lightfoot,D., Hall,R.M. and Djordjevic,S.P., "New integron-associated gene cassette encoding a 3-N-aminoglycoside acetyltransferase", Antimicrob. Agents Chemother. 49 (3), 1238-1241 (2005) PUBMED 15728939.

    -Partridge,S.R., Levings,R.S., Hall,R.M. and Djordjevic,S.P., "Direct Submission", Submitted (15-NOV-2004) Microbiology and Immunology Section, New South Wales Argiculture, Elizabeth Macarthur Agricultural Institute, Camden NSW 2570, Australia.

    -Wilson,N.L. and Hall,R.M., "Unusual class 1 integron configuration found in Salmonella genomic island 2 from Salmonella enterica serovar Emek", Antimicrob. Agents Chemother. 54 (1), 513-516 (2010) PUBMED 19884375.

    -Wilson,N.L., Levings,R.S. and Hall,R.M., "Direct Submission", Submitted (06-OCT-2009) NSW Department of Primary Industries, Elizabeth Macarthur Agricultural Institute, PMB 8, Camden NSW 2570, Australia REMARK Sequence update by submitter.


DNA sequence :
GTGATATCATCACCTCATAAGTTAACAGGTGACATTATGACAAAACGTACAAGACGACTATTTAGCGCAGAATTTAAGTT
AGAAGCAGCGCAGCTAGTCTTAGACCAAAATTACTCAGTGACGGAAGCAGCCCAAGCCATGAATGTGGGCAAGTCCACGA
TGGATAAATGGGTTCGCCAGCTTAGAGAAGAACGCCAAGGGAAAACACCTAAAGCTTCACCTATGACCCCTGAGCAAATA
GAAATTCGGGAATTGAAAAAGAAGCTGGCTCGCCTTGAAGAGCATAATGAAATACTAAAAAAAGCCACGGCTCTCTTGAT
GTCGGACTCACTGAACAATTCTTGA

Protein sequence :
MISSPHKLTGDIMTKRTRRLFSAEFKLEAAQLVLDQNYSVTEAAQAMNVGKSTMDKWVRQLREERQGKTPKASPMTPEQI
EIRELKKKLARLEEHNEILKKATALLMSDSLNNS