PAI Gene Information


Name : unnamed
Accession : ADD91748.1
PAI name : PAI-I AL862
PAI accession : GQ497943
Strain : Escherichia coli 042
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : ORF00049
Homologs in the searched genomes :   No hits  
Publication :
    -Martinez-Jehanne,V., du Merle,L., Pichon,C., Ma,L., Bouchier,C. and Le Bouguenec,C., "Sequence of the PAI-I of Escherichia coli strain AL862", Unpublished.

    -Martinez-Jehanne,V., du Merle,L., Pichon,C., Ma,L., Bouchier,C. and Le Bouguenec,C., "Direct Submission", Submitted (20-AUG-2009) Microbiology, Institut Pasteur, 25-28 Rue du Docteur Roux, Paris 75724, France.

    -Martinez-Jehanne,V., Pichon,C., du Merle,L., Poupel,O., Cayet,N., Bouchier,C. and Le Bouguenec,C., "Role of the Vpe Carbohydrate Permease in Escherichia coli Urovirulence and Fitness In Vivo", Infect. Immun. 80 (8), 2655-2666 (2012) PUBMED 22615242.


DNA sequence :
GTGGCTGAGCCGTACCGGTATGCCGGGTGGTTGTTACGAAACGATGCTTCCGCACGCGTGCGCGATAAAGAAGGGATGAT
TTTCGTGAGGAAGAGGGGAAAACTGGCGTTCTGA

Protein sequence :
MAEPYRYAGWLLRNDASARVRDKEGMIFVRKRGKLAF