PAI Gene Information


Name : cdd3
Accession : CAA63568.1
PAI name : PaLoc
PAI accession : X92982
Strain : Clostridium difficile 2007855
Virulence or Resistance: Not determined
Product : -
Function : -
Note : -
Homologs in the searched genomes :   6 hits    ( 6 protein-level )  
Publication :
    -Hundsberger,T., Braun,V., Weidmann,M., Leukel,P., Sauerborn,M. and von Eichel-Streiber,C., "Transcription analysis of the genes tcdA-E of the pathogenicity locus of Clostridium difficile", Eur. J. Biochem. 244 (3), 735-742 (1997) PUBMED 9108241.

    -von Eichel-Streiber,C., "Direct Submission", Submitted (13-NOV-1995) C. Von Eichel-Streiber, Inst. fr Medizinische Mikrobiologie, AG von Eichel, Hochhaus am Augustusplatz, D- 55101 Mainz, FRG.


DNA sequence :
ATGAAATACCTTGGTCTAGAATTTTATAAACTTAAAAGAAAGAAGATTATTCTGATGACCTTTTTATTTGTAGCTGTTGA
AATAATGTGGTGTATCGTAAATTCAAATAGGGCTATTACACGTAATCCAGATATGTTAGGTGGATTTGAATATTCCTATA
TGCTTATGAGTTTTGCAAGTTTAAATGGTCTATTCTTTCCTATCTTAATATCAATAATTACATCACGTATAAGCGATATA
GAACATAAAGGAGATACATGGAAGCTTTTAAAATCTTCTGTGACATCTTTAAATACTATTTATTTATCTAAATTTTTATG
TTCTGCTATTTTGGTATCTATACCTGTATTGATGCAAGTGTTATCTATTGTGTTGTTTGGACATTTTAGAGGGGTTATTG
AGTCAATTTCTGTATCTTTACTTTTAAAATACACATTAGGAACAATTCTTGTAAGTATTGCTATCATTGCACTACACCTA
TGGATTGCAACTGTAATTCCAAATCAAATGATTGCAATTACATTTGGCATGATTGGTAGTTTTATAGGTTTGACATCAGG
TTTGTTTTATCAAGGTATTCGTAGATTGTTTATATGGTCTTATTACCTAGAGTTATCACCTTTAAGTTATGCTTATGATA
ATGTTTTAGGTTCATCTGTCTATAGAATTGATATGAATTTTTCTATTACGATTTTAGTTTTCTTAATTGGAATGCTAATT
TATTATATTGGAAGAAATCATTTATTAAAAAAAGAAGTATAG

Protein sequence :
MKYLGLEFYKLKRKKIILMTFLFVAVEIMWCIVNSNRAITRNPDMLGGFEYSYMLMSFASLNGLFFPILISIITSRISDI
EHKGDTWKLLKSSVTSLNTIYLSKFLCSAILVSIPVLMQVLSIVLFGHFRGVIESISVSLLLKYTLGTILVSIAIIALHL
WIATVIPNQMIAITFGMIGSFIGLTSGLFYQGIRRLFIWSYYLELSPLSYAYDNVLGSSVYRIDMNFSITILVFLIGMLI
YYIGRNHLLKKEV