PAI Gene Information


Name : unnamed
Accession : CAB57394.1
PAI name : HPI
PAI accession : AJ238284
Strain : Yersinia enterocolitica 8081
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : ORF1
Homologs in the searched genomes :   No hits  
Publication :
    -Bach,S., "Direct Submission", Submitted (16-APR-1999) Bach S., Bacteriologie Moleculaire et Medicale (laboratoire des Yersinia), Institut Pasteur, 28, rue du Docteur Roux, 75724 Paris Cedex 15, FRANCE.

    -Bach,S., Buchrieser,C., Prentice,M., Guiyoule,A., Msadek,T. and Carniel,E., "The high-pathogenicity island of Yersinia enterocolitica Ye8081 undergoes low-frequency deletion but not precise excision, suggesting recent stabilization in the genome", Infect. Immun. 67 (10), 5091-5099 (1999) PUBMED 10496882.

    -Bach,S., Buchrieser,C., Prentice,M., Guiyoule,A., Msadek,T. and Carniel,E., "The HPI of Yersinia enterocolitica does not possess the determinants necessary for its precise excision", Unpublished.


DNA sequence :
AGATCTTCCAATTCCCGGATGGTGTTATTTGGGATAGAAGCAATGTGATGTTTATTGCCATTGGCGTTATCGCAAAAGAA
AAAGAGCATATCGATGTGCTAAAAGATATTGCCTCGATCTTTAGTGATGAAATTATTGCTAATGCACTTTCGCTGATTTC
AAGTAAGCAGGATTTTCTGCGTATTCTTAATCGAAAATAG

Protein sequence :
IFQFPDGVIWDRSNVMFIAIGVIAKEKEHIDVLKDIASIFSDEIIANALSLISSKQDFLRILNRK