PAI Gene Information


Name : sdhB
Accession : CAD42865.1
PAI name : trw-PAI
PAI accession : AJ496288
Strain : Bartonella tribocorum CIP 105476
Virulence or Resistance: Not determined
Product : putative succinate dehydrogenase iron-sulfur protein subunit B
Function : -
Note : -
Homologs in the searched genomes :   1046 hits    ( 1046 protein-level )  
Publication :
    -Seubert,A.K., "Direct Submission", Submitted (19-JUL-2002) Seubert A.K., Molecular Microbiology, Biozentrum of the University of Basel, Klingelbergstr. 70, CH-4056 Basel, SWITZERLAND.

    -Seubert,A.K., Hiestand,R., de la Cruz,F. and Dehio,C., "A broad-host-range plasmid conjugation machinery recruited for bacterial pathogenesis", Unpublished.


DNA sequence :
ATGGTACAAATTAAACTTCCCAAAAACTCTCAAGTAAAACCAGGAAAGGTTTGGCCTAAACCTGAAGGGGCTACAAAGCT
GACGGAATTTCACGTGTATCGTTGGTCGCCTGATGATGAGGAAAATCCTCATCTAGATACCTATTATGTCGATCGTTCTG
CTTGTGGTCCTATGATTCTTGATGGGCTTTTGTTTATTAAAAACCATATTGACCCAACTTTGACATTTCGCCGATCATGC
CGTGAAGGCATCTGCGGTTCCTGTGCGATGAATATTGATGGGACCAATACATTGGCTTGTACCAAAGGTATGGATGATGT
AAAACACCCCATTAAGGTCTATCCTCTGCCTTCCATGCCGGTTGTTAAAGATTTGGTTCCTGATTTAAATCGCTTTTATG
CCCAACACCGAGTCATTGAGCCTTGGTTGCAAACTGTTTCGCCTGAACCTGCGAAAGAGTGGTTACAAAGTCACTCCGAC
CGCCAAAAAATTGATGGTCTTTATGAATGTATTTTATGTGCATGTTGTCAGACATCATGTCCGAGTTATTGGTGGAATGG
TGATCGCTATTTGGGCCCCGCTGTTTTGCTCCAAGCTTATCGTTGGATTGCGGATTCACGTGATGAGATGTGTGGTGAAC
GTCTTGATAATTTAGAAGATCCTTTCCGCCTTTATCGCTGTCATACGATTATGAATTGTACGCAAACTTGTCCAAAAGGA
TTAAATCCGGCGAAAGCGATTGCTGAAATTAAAAAACTTATGGTTGAACGCCGCCTTTAA

Protein sequence :
MVQIKLPKNSQVKPGKVWPKPEGATKLTEFHVYRWSPDDEENPHLDTYYVDRSACGPMILDGLLFIKNHIDPTLTFRRSC
REGICGSCAMNIDGTNTLACTKGMDDVKHPIKVYPLPSMPVVKDLVPDLNRFYAQHRVIEPWLQTVSPEPAKEWLQSHSD
RQKIDGLYECILCACCQTSCPSYWWNGDRYLGPAVLLQAYRWIADSRDEMCGERLDNLEDPFRLYRCHTIMNCTQTCPKG
LNPAKAIAEIKKLMVERRL