PAI Gene Information


Name : ECs4539 (ECs4539)
Accession : NP_312566.1
PAI name : LEE
PAI accession : NC_002695_P2
Strain : Escherichia coli 042
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : similar to L0007 [Escherichia coli EDL933] gi|3414875|gb|AAC31486.1|, hypothetical proteins e.g. b2005 (yeeV) [Escherichia coli] gi|3025158|sp|P76365|YEEV_ECOLI
Homologs in the searched genomes :   204 hits    ( 198 protein-level,   6 DNA-level )  
Publication :
    -Bergholz,T.M., Wick,L.M., Qi,W., Riordan,J.T., Ouellette,L.M. and Whittam,T.S., "Global transcriptional response of Escherichia coli O157:H7 to growth transitions in glucose minimal medium", BMC Microbiol. 7, 97 (2007) PUBMED 17967175 REMARK Publication Status: Online-Only.

    -Hayashi,T., Makino,K., Ohnishi,M., Kurokawa,K., Ishii,K., Yokoyama,K., Han,C.G., Ohtsubo,E., Nakayama,K., Murata,T., Tanaka,M., Tobe,T., Iida,T., Takami,H., Honda,T., Sasakawa,C., Ogasawara,N., Yasunaga,T., Kuhara,S., Shiba,T., Hattori,M. and Shinagawa,H., "Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and genomic comparison with a laboratory strain K-12", DNA Res. 8 (1), 11-22 (2001) PUBMED 11258796 REMARK Erratum:[DNA Res 2001 Apr 27;8(2):96].

    -Makino,K., Yokoyama,K., Kubota,Y., Yutsudo,C.H., Kimura,S., Kurokawa,K., Ishii,K., Hattori,M., Tatsuno,I., Abe,H., Iida,T., Yamamoto,K., Onishi,M., Hayashi,T., Yasunaga,T., Honda,T., Sasakawa,C. and Shinagawa,H., "Complete nucleotide sequence of the prophage VT2-Sakai carrying the verotoxin 2 genes of the enterohemorrhagic Escherichia coli O157:H7 derived from the Sakai outbreak", Genes Genet. Syst. 74 (5), 227-239 (1999) PUBMED 10734605.

    -Makino,K., Yokoyama,K., Kubota,Y., Yutsudo,C.H., Kimura,S., Kurokawa,K., Ishii,K., Hattori,M., Tatsuno,I., Abe,H., Iida,T., Yamamoto,K., Onishi,M., Hayashi,T., Yasunaga,T., Honda,T., Sasakawa,C. and Shinagawa,H., "Direct Submission", Submitted (10-SEP-2004) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.

    -Makino,K., Yokoyama,K., Kubota,Y., Yutsudo,C.H., Kimura,S., Kurokawa,K., Ishii,K., Hattori,M., Tatsuno,I., Abe,H., Iida,T., Yamamoto,K., Onishi,M., Hayashi,T., Yasunaga,T., Honda,T., Sasakawa,C. and Shinagawa,H., "Direct Submission", Submitted (25-JUN-2001) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.

    -Ohnishi,M., Murata,T., Nakayama,K., Kuhara,S., Hattori,M., Kurokawa,K., Yasunaga,T., Yokoyama,K., Makino,K., Shinagawa,H. and Hayashi,T., "Comparative analysis of the whole set of rRNA operons between an enterohemorrhagic Escherichia coli O157:H7 Sakai strain and an Escherichia coli K-12 strain MG1655", Syst. Appl. Microbiol. 23 (3), 315-324 (2000) PUBMED 11108008.

    -Yokoyama,K., Makino,K., Kubota,Y., Watanabe,M., Kimura,S., Yutsudo,C.H., Kurokawa,K., Ishii,K., Hattori,M., Tatsuno,I., Abe,H., Yoh,M., Iida,T., Ohnishi,M., Hayashi,T., Yasunaga,T., Honda,T., Sasakawa,C. and Shinagawa,H., "Complete nucleotide sequence of the prophage VT1-Sakai carrying the Shiga toxin 1 genes of the enterohemorrhagic Escherichia coli O157:H7 strain derived from the Sakai outbreak", Gene 258 (1-2), 127-139 (2000) PUBMED 11111050.


DNA sequence :
ATGAAAACATTACCCGATACACACGTACGGGAGGCATCGCGCTGCCCGTCTCCCATCACCATCTGGCAGACACTGCTTGG
CCGTCTGCTGGACCAGCACTACGGCCTCACGCTGAATGACACACCGTTCGCTGATGAACGTGTGATTGAGCAGCATATTG
AGGCAGGTATTTCACTGTGTGATGCGGTGAACTTTCTCGTGGAAAAATACGTGCTGGTGCGTACCGACCAGCCGGGATTC
AGCGCCTGTACCCGCTCTCAGTTAATAAACAGCATCGATATCCTCCGGGCTCGCAGGGCGACCGGCCTGATGACCCGCGA
CAATTACAGAACGGTAAATAACATTACCCTGGGTAAGCATCCGGAGGCGAAATGA

Protein sequence :
MKTLPDTHVREASRCPSPITIWQTLLGRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK