PAI Gene Information


Name : CMM_0065 (CMM_0065)
Accession : YP_001220804.1
PAI name : chp/tomA region
PAI accession : NC_009480_P1
Strain : Clavibacter michiganensis NCPPB 382
Virulence or Resistance: Not determined
Product : putative phosphotransferase
Function : -
Note : conserved hypothetical protein, putative phosphotransferase (NP_977552.1| trifolitoxin immunity domain protein [Bacillus cereus ATCC 10987]; ZP_00200969.1| COG3173: Predicted aminoglycoside phosphotransferase [Exiguobacterium sp. 255-15]).
Homologs in the searched genomes :   1 hits    ( 1 protein-level )  
Publication :
    -Gartemann,K.H., Abt,B., Bekel,T., Burger,A., Engemann,J., Flugel,M., Gaigalat,L., Goesmann,A., Grafen,I., Kalinowski,J., Kaup,O., Kirchner,O., Krause,L., Linke,B., McHardy,A., Meyer,F., Pohle,S., Ruckert,C., Schneiker,S., Zellermann,E.M., Puhler,A., Eiche, "The genome sequence of the tomato-pathogenic actinomycete Clavibacter michiganensis subsp. michiganensis NCPPB382 reveals a large island involved in pathogenicity", J. Bacteriol. 190 (6), 2138-2149 (2008) PUBMED 18192381.

    -Gartemann,K.H., Abt,B., Bekel,T., Burger,A., Engemann,J., Flugel,M., Gaigalat,L., Goesmann,A., Grafen,I., Kalinowski,J., Kaup,O., Kirchner,O., Krause,L., Linke,B., McHardy,A., Meyer,F., Pohle,S., Ruckert,C., Schneiker,S., Zellermann,E.M., Puhler,A., Eiche, "Direct Submission", Submitted (23-MAY-2007) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.

    -Linke,B., "Direct Submission", Submitted (10-MAY-2007) Linke B., Center For Biotechnology, Bielefeld University, Universitaetsstrasse 25, 33501 Bielefeld, GERMANY.


DNA sequence :
ATGCAAGTGCTAGCACTACAAACGCGAGGAGTCAACACAGTGAGTGCCACGGAACCCCTCTCTGGCGGTAATTCTGCTCC
GGTTATATATCGTCAGGGGAATGTCGTCTATAAATCGTCGCACGAGTCTACTCCGGCCGTCGGGCGCCTCTTGCGGTACC
TTGAACAACGAGCGCCAGGTTTAACGCCGCGATTTAGTGGTGTGGGAGACGACGGACTGCAGCGCTTAGAGTACATCCCT
GGTCACCTCCTCGCCGACCAAGGGCGTCTTTCAGACACGGCTCTACGGGACGCAGGTGCGGCAATCCGCGAATTACACGA
CGCCCTGGAGTCGTACAAGCCAAATGCGATGGACAGATTTTACCCTAGCTTTCCTACGGAAGCTGGATCTATACTGTGTC
ACAATGATCTGTCGCCCTGGAACTTCATTCTCCGACCCGATGGCTCTATGTGTATCATCGACTGGGACGGCGTCGGTTGG
GGGGCACGTGAATGGGACCTGGGGTACGCGATAAAGACGTTTGTGGGTCTCGAGCCTGGTACTGGAGTTGCGAACAACGG
TACACGAATGTGTATCTTTCTTGACGGGTATCGTTGGAGTGGATCGCCCGATTTGATACTTTCCAATGTTCTTCTTCGAA
CAGAATCTATGCGTGATTTGCTCGAAACGGGAAAGCGGAATAATACGCCTCCTTGGTCACGTTTATACGATGAAGGGCAC
TGGGGTTATTGGTCGGATTGCTATGACTACATTGCAAGCAATATGGAGCACTGGCGGGCGCCCCTATTCCGTCGCGGTAT
TGAATAG

Protein sequence :
MQVLALQTRGVNTVSATEPLSGGNSAPVIYRQGNVVYKSSHESTPAVGRLLRYLEQRAPGLTPRFSGVGDDGLQRLEYIP
GHLLADQGRLSDTALRDAGAAIRELHDALESYKPNAMDRFYPSFPTEAGSILCHNDLSPWNFILRPDGSMCIIDWDGVGW
GAREWDLGYAIKTFVGLEPGTGVANNGTRMCIFLDGYRWSGSPDLILSNVLLRTESMRDLLETGKRNNTPPWSRLYDEGH
WGYWSDCYDYIASNMEHWRAPLFRRGIE