PAI Gene Information


Name : trwH2 (Btr_2523a)
Accession : YP_001610482.1
PAI name : Not named
PAI accession : NC_010161_P3
Strain : Bartonella tribocorum CIP 105476
Virulence or Resistance: Virulence
Product : TrwH2 protein
Function : -
Note : Component of type IV secretion system; hypothetical protein
Homologs in the searched genomes :   13 hits    ( 13 protein-level )  
Publication :
    -Saenz,H.L., Engel,P., Stoeckli,M.C., Lanz,C., Raddatz,G., Vayssier-Taussat,M., Birtles,R., Schuster,S.C. and Dehio,C., "Genomic analysis of Bartonella identifies type IV secretion systems as host adaptability factors", Nat. Genet. 39 (12), 1469-1476 (2007) PUBMED 18037886.

    -Saenz,H.L., Engel,P., Stoeckli,M.C., Lanz,C., Raddatz,G., Vayssier-Taussat,M., Birtles,R., Schuster,S.C. and Dehio,C., "Direct Submission", Submitted (14-DEC-2007) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.

    -Schuster,S.C., "Direct Submission", Submitted (30-MAR-2006) Schuster S.C., Department of Biochemistry and Molecular Biology, Center for Comparative Genomics and Bioinformatics Center for Infectious Disease Dynamics, 310 Wartik Building, Penn State University, University Park, PA 16802, USA .


DNA sequence :
GTGAAGTCGGTTGTTTTTATAATTTTGATTGCAAATCTTTTATCGGCTTGTGCATTAGCACCAAAGCTAAAACAACCTAA
TGATAGAAACCGTGTGCCTATTAATAAAACAATCCCTGCCGAAATCAAGCGAGGAGACAGATGA

Protein sequence :
MKSVVFIILIANLLSACALAPKLKQPNDRNRVPINKTIPAEIKRGDR