PAI Gene Information


Name : Bsph_2818 (Bsph_2818)
Accession : YP_001698482.1
PAI name : Not named
PAI accession : NC_010382_P2
Strain : Lysinibacillus sphaericus C3-41
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   15 hits    ( 15 protein-level )  
Publication :
    -Hu,X., Fan,W., Han,B., Liu,H., Zheng,D., Li,Q., Dong,W., Yan,J., Gao,M., Berry,C. and Yuan,Z., "Complete genome sequence of the mosquitocidal bacterium Bacillus sphaericus C3-41 and comparison with those of closely related Bacillus species", J. Bacteriol. 190 (8), 2892-2902 (2008) PUBMED 18296527.

    -Hu,X., Fan,W., Han,B., Liu,H., Zheng,D., Li,Q., Dong,W., Yan,J., Gao,M., Berry,C. and Yuan,Z., "Direct Submission", Submitted (13-MAR-2008) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.

    -Yuan,Z., Hu,X., Zheng,D., Yan,J. and Cai,Q., "Direct Submission", Submitted (23-AUG-2007) State Key Laboratory of Virology, Wuhan Institute of Virology, Chinese Academy of Sciences, Wuchang Xiaohongshan Zhongqu 44, Wuhan, Hubei 430071, P.R.China.


DNA sequence :
GTGATCGTTGCTATCAGTACACACCAAACATTTGAAGCGTTACAACAAGCGATTGAGGATTATATCCAGTTTTACAATAA
CGATAGATACCAAGAACGATTAAACGGCTTAAGCCCATTAGAATACAGGGCTAAAGCCGCTTAA

Protein sequence :
MIVAISTHQTFEALQQAIEDYIQFYNNDRYQERLNGLSPLEYRAKAA