PAI Gene Information


Name : ECUMN_3360 (ECUMN_3360)
Accession : YP_002414035.1
PAI name : Not named
PAI accession : NC_011751_P1
Strain : Escherichia coli 042
Virulence or Resistance: Not determined
Product : transposase ORF A (fragment), IS3 family
Function : -
Note : Evidence 7 : Gene remnant; Product type pe : putative enzyme
Homologs in the searched genomes :   4 hits    ( 4 protein-level )  
Publication :
    -Genoscope -,C.E.A., "Direct Submission", Submitted (14-DEC-2008) Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).

    -Touchon,M., Hoede,C., Tenaillon,O., Barbe,V., Baeriswyl,S., Bidet,P., Bingen,E., Bonacorsi,S., Bouchier,C., Bouvet,O., Calteau,A., Chiapello,H., Clermont,O., Cruveiller,S., Danchin,A., Diard,M., Dossat,C., Karoui,M.E., Frapy,E., Garry,L., Ghigo,J.M., Gill, "Organised genome dynamics in the Escherichia coli species results in highly diverse adaptive paths", PLoS Genet. 5 (1), E1000344 (2009) PUBMED 19165319.

    -Touchon,M., Hoede,C., Tenaillon,O., Barbe,V., Baeriswyl,S., Bidet,P., Bingen,E., Bonacorsi,S., Bouchier,C., Bouvet,O., Calteau,A., Chiapello,H., Clermont,O., Cruveiller,S., Danchin,A., Diard,M., Dossat,C., Karoui,M.E., Frapy,E., Garry,L., Ghigo,J.M., Gill, "Direct Submission", Submitted (18-DEC-2008) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.


DNA sequence :
ATGAATGTTGGTTTCTCTACTCTGGAGGCATGGGTATGTCAGCTCAGACGGGAACGTCAGGAGATCACGCCTTCTGCAGC
ACCATTCACATCAGAGCAGCAATGTATTCGTGAGCTGGAAAAGCAGGTGCGTGTAAGCGTCAACGGAGCACCGTATTGA

Protein sequence :
MNVGFSTLEAWVCQLRRERQEITPSAAPFTSEQQCIRELEKQVRVSVNGAPY