PAI Gene Information


Name : SAOV_1111 (SAOV_1111)
Accession : YP_005736606.1
PAI name : phi_Sa2
PAI accession : NC_017337_P3
Strain : Staphylococcus aureus 04-02981
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   16 hits    ( 16 protein-level )  
Publication :
    -Guinane,C.M., Ben Zakour,N.L., Tormo-Mas,M.A., Weinert,L.A., Lowder,B.V., Cartwright,R.A., Smyth,D.S., Smyth,C.J., Lindsay,J., Gould,K.A., Witney,A., Hinds,J., Bollback,J.P., Rambaut,A., Penades,J. and Fitzgerald,J.R., "Direct Submission", Submitted (29-MAR-2010) The Roslin Institute and Centre for Infectious Diseases, Royal (Dick) School of Veterinary Studies, University of Edinburgh, The Chancellor's Building, New Royal Infirmary, 49 Little France Crescent, Edinburgh EH16 4SB, United King.

    -Guinane,C.M., Ben Zakour,N.L., Tormo-Mas,M.A., Weinert,L.A., Lowder,B.V., Cartwright,R.A., Smyth,D.S., Smyth,C.J., Lindsay,J.A., Gould,K.A., Witney,A., Hinds,J., Bollback,J.P., Rambaut,A., Penades,J.R. and Fitzgerald,J.R., "Evolutionary genomics of Staphylococcus aureus reveals insights into the origin and molecular basis of ruminant host adaptation", Genome Biol Evol 2, 454-466 (2010) PUBMED 20624747 REMARK Publication Status: Online-Only.

    -Guinane,C.M., Ben Zakour,N.L., Tormo-Mas,M.A., Weinert,L.A., Lowder,B.V., Cartwright,R.A., Smyth,D.S., Smyth,C.J., Lindsay,J.A., Gould,K.A., Witney,A., Hinds,J., Bollback,J.P., Rambaut,A., Penades,J.R. and Fitzgerald,J.R., "Direct Submission", Submitted (05-APR-2012) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.


DNA sequence :
TTGAAATACACAACAAAACAAACAGATATTGTTTCTATAAGTGATGACGGACAAATAACGGCAAAATCACAAGGTATTGC
TACAGTAACGGCTATAGCCGGAAACAAAAGTGACTCAATTACAATAAATGTAGAAGGTTAA

Protein sequence :
MKYTTKQTDIVSISDDGQITAKSQGIATVTAIAGNKSDSITINVEG