PAI Gene Information


Name : CPR_0657 (CPR_0657)
Accession : YP_697984.1
PAI name : Not named
PAI accession : NC_008262_P4
Strain : Clostridium perfringens ATCC 13124
Virulence or Resistance: Not determined
Product : hypothetical protein
Function : -
Note : -
Homologs in the searched genomes :   6 hits    ( 6 protein-level )  
Publication :
    -Myers,G.S., Rasko,D.A., Cheung,J.K., Ravel,J., Seshadri,R., DeBoy,R.T., Ren,Q., Varga,J., Awad,M.M., Brinkac,L.M., Daugherty,S.C., Haft,D.H., Dodson,R.J., Madupu,R., Nelson,W.C., Rosovitz,M., Sullivan,S.A., Khouri,H.M., Dimitrov,G., Watkins,K.L., Mulligan, "Direct Submission", Submitted (06-APR-2006) The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD 20850, USA.

    -Myers,G.S., Rasko,D.A., Cheung,J.K., Ravel,J., Seshadri,R., DeBoy,R.T., Ren,Q., Varga,J., Awad,M.M., Brinkac,L.M., Daugherty,S.C., Haft,D.H., Dodson,R.J., Madupu,R., Nelson,W.C., Rosovitz,M.J., Sullivan,S.A., Khouri,H., Dimitrov,G.I., Watkins,K.L., Mullig, "Skewed genomic variability in strains of the toxigenic bacterial pathogen, Clostridium perfringens", Genome Res. 16 (8), 1031-1040 (2006) PUBMED 16825665.

    -Myers,G.S., Rasko,D.A., Cheung,J.K., Ravel,J., Seshadri,R., DeBoy,R.T., Ren,Q., Varga,J., Awad,M.M., Brinkac,L.M., Daugherty,S.C., Haft,D.H., Dodson,R.J., Madupu,R., Nelson,W.C., Rosovitz,M.J., Sullivan,S.A., Khouri,H., Dimitrov,G.I., Watkins,K.L., Mullig, "Direct Submission", Submitted (28-JUL-2006) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.


DNA sequence :
ATGATGAATACGAATATGTATAAAAAAATAACATTAAAAGAAAATAAAACTCTTAAATTAAAAAATGTATTAAGTAGAGA
GTTAACTCAAAGCGAATTTATGAATGAAAATAAAATTATGTATATGATGGAAAGTTACATAAAGTCAAAGGGTAATTCTA
TAGTTGGACCTATGATAAATTATTCATCAATTATAAGTGGAGAAAATGGACAACCTAAGTTAGTTGCTAAGCTTATGGTA
CAACTTAAAGAAACTATAGAAAACTTGGAAGAACCTTATGAATTTAGTTCACAAATAAGAGTCCCCAATTGCTTGTTTGC
AAGATTTATTGAAAAGGAACAAAATCTTCAATTTGCTTATGCAAAGTTAAACTTACATGCATTTGAAAATAACATTAAAT
TATTAGGAGATAACTATACTATTTTTGTTGAAAGAAATAAAAATAATATTGTAGCAGATATATTTATGCAAATGCAAAAT
GAGGTAGGTCCAATTGAAAATATATAG

Protein sequence :
MMNTNMYKKITLKENKTLKLKNVLSRELTQSEFMNENKIMYMMESYIKSKGNSIVGPMINYSSIISGENGQPKLVAKLMV
QLKETIENLEEPYEFSSQIRVPNCLFARFIEKEQNLQFAYAKLNLHAFENNIKLLGDNYTIFVERNKNNIVADIFMQMQN
EVGPIENI