Name : unnamed Accession : AAL26682.1 REI name : SCCcap1 REI accession : U10927 Strain : Staphylococcus aureus 04-02981 Resistance or Virulence: Not determined Product : unknown Function : - Note : ORF CM08 Homologs in the searched genomes : No hits Publication :
-Lin,W.S., Cunneen,T. and Lee,C.Y., "Sequence analysis and molecular characterization of genes required for the biosynthesis of type 1 capsular polysaccharide in Staphylococcus aureus", J. Bacteriol. 176 (22), 7005-7016 (1994) PUBMED 7961465. -Luong,T.T., Ouyang,S., Bush,K. and Lee,C.Y., "Type 1 capsule genes of Staphylococcus aureus are carried in a staphylococcal cassette chromosome genetic element", J. Bacteriol. 184 (13), 3623-3629 (2002) PUBMED 12057957. -Luong,T.T., Shu,O., Bush,K. and Lee,C.Y., "Direct Submission", Submitted (01-NOV-2001) Department of Microbiology, University of Kansas Medical Center, 3901 Rainbow Blvd., Kansas City, KS 66106, USA REMARK Sequence update by submitter. DNA sequence : ATGAAGAAATTTAACAACTGGATATTAAATGCAATAAGTGGATCTCAAACAGACAAGAATGGAACAACTGAAGAATTAAA AGGGGCAAAATTTATCATTTTATATGCATATTCAATGCTCGTTTTGCTTGCGTTAGTAATTTCTAACATATTCATTCACA TTTTGGAGCCTAAATTATCAATCACCACTCAAATCATCATCGTTTTGATTTTAATTGAATCACTAATTGGACTACGTTTC TTGCAAAGGGTACGATGTTAG Protein sequence : MKKFNNWILNAISGSQTDKNGTTEELKGAKFIILYAYSMLVLLALVISNIFIHILEPKLSITTQIIIVLILIESLIGLRF LQRVRC |