REI Gene Information


Name : merE
Accession : ACF06180.1
REI name : Tn5036-like
REI accession : EU780013
Strain : Klebsiella pneumoniae SB3432
Resistance or Virulence: Not determined
Product : mercuric resistance protein
Function : -
Note : -
Homologs in the searched genomes :   40 hits    ( 40 protein-level )  
Publication :
    -Marquez,C., Labbate,M., Raymondo,C., Fernandez,J., Gestal,A.M., Holley,M., Borthagaray,G. and Stokes,H.W., "Urinary tract infections in a South american population: dynamic spread of class 1 integrons and multidrug resistance by homologous and site-specific recombination", J. Clin. Microbiol. 46 (10), 3417-3425 (2008) PUBMED 18753343.

    -Marquez,C., Labbate,M., Raymondo,C., Fernandez,J., Gestal,A.M., Holley,M., Borthagaray,G. and Stokes,H.W., "Direct Submission", Submitted (29-MAY-2008) Chemistry and Biomolecular Sciences, Macquarie University, Balaclava Rd., North Ryde, Sydney, NSW 2109, Australia.


DNA sequence :
GTGAACGCCCCTGACAAACTGCCGCCCGAGACGCGCCAACCCGTTTCCGGCTACCTGTGGGGTGCGCTGGCCGTGTTGAC
CTGCCCCTGCCATCTGCCGATTCTCGCCGCCGTGCTGGCCGGGACGACCGCCGGTGCCTTCCTTGGCGAGCATTGGGGTG
TTGCCGCGCTCGCGCTGACCGGCTTGTTCGTTCTGGCCGTAACGCGGCTGCTGCGCGCCTTCCGGGGCGGATCATGA

Protein sequence :
MNAPDKLPPETRQPVSGYLWGALAVLTCPCHLPILAAVLAGTTAGAFLGEHWGVAALALTGLFVLAVTRLLRAFRGGS